KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101139984Help
Entry
101139984         CDS       T02442                                 

Gene name
PLCD1
Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 isoform 1
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101139984 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101139984 (PLCD1)
   04070 Phosphatidylinositol signaling system
    101139984 (PLCD1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101139984 (PLCD1)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101139984 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 756 aa AA seqDB search
MDSGRDFLTLHGLQDDEDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMR
TPESQLFSIEDIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH
WVLGLHKIIHHSGSMDQRQKLQHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSY
ARKIFRECDHSQTDSLEDEEIEAFYKMLTQRVEIDRTFAEAAGSGETLSVDQLVTFLQHQ
QREEVAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMGQ
PLSHYLVSSSHNTYLLEDQLAGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTF
TSKILFCDVLRAIRDYAFKASPYPVILSLENHCTLEQQRVMARHLHAILGPMLLNRPLDG
VTNSLPSPEQLKGKILLKGKKLGGLLPPGGEGGPEATVVSDEDEAAEMEDEAVRSRVQHK
PKEDKLRLAQELSDMVIYCKSVHFGGFSSPGTPGQAFYEMASFSENRALRLLQESGNGFV
RHNVGHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYQGRFQDNGACG
YVLKPAFLRDPNGTFNPRALAQGPWWARKRLNIRVISGQQLPKVNKNKNSIVDPKVTVEI
HGVSRDVASRQTAVITNNGFNPWWDTEFAFEVVVPDLALVRFLVEDYDASSKNDFIGQST
IPLNSLKQGYRHVHLMSKNGDQHPSATLFVKISLQD
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggactcgggccgggacttcctgaccctgcacggcctacaggatgatgaggatctacag
gcgctgctgaagggcagccagctcctgaaggtgaagtccagctcatggaggagagagcgc
ttctacaagttgcaggaggactgcaagaccatctggcaggagtcccgcaaggtcatgcgg
accccggagtcccagctgttctccatcgaggacattcaggaggtgcgaatggggcaccgc
acggagggtctggagaagttcgcccgtgatgtgcccgaggaccgctgcttctccattgtc
ttcaaggaccagcgcaatacactagacctcatcgccccatcgccagctgatgcccagcac
tgggtgctggggctgcacaagatcatccaccactcaggctccatggaccagcgtcagaag
ctacagcactggattcactcctgcttgcgaaaagctgacaaaaacaaggacaacaagatg
agcttcaaggagctgcagaacttcctgaaggagctcaacatccaggtggacgacagctat
gcccggaagatcttcagggagtgtgaccactcccagacagactccctggaggatgaggag
attgaggccttctacaagatgctgacccagcgggtggagatcgaccgcaccttcgctgag
gccgcgggctcaggggagactctgtcggtggatcagttagtgacgttcctgcagcaccag
cagcgggaggaggtggcagggcctgcgctggccctctccctcattgagcgctacgagccc
agcgagactgccaaggcgcagcggcagatgaccaaggacggcttcctcatgtacttactg
tcggctgacggcagcgccttcagcctagcacaccgccgtgtctaccaggacatgggccag
ccgcttagccactacctggtgtcctcttcacacaacacctacctgctggaggaccagcta
gccgggcccagcagcactgaagcctacatccgggcactgtgcaaaggctgccgatgcctg
gagcttgactgctgggacgggcccaaccaggaaccaatcatctaccacggctatactttc
acttccaagatcctcttctgcgatgtgctcagggccatccgggactatgccttcaaggcg
tccccctaccctgtcatcctatccctggagaaccactgcacactggagcagcagcgcgtg
atggcgcggcacctgcatgccatcctgggccccatgctgttgaaccgaccactggatggg
gtcaccaacagcctgccctcccctgagcaactgaaggggaagatcctgctgaaggggaag
aagctcggggggctcctgccccctggaggggagggtggccctgaggccactgtggtgtct
gacgaagacgaggctgctgagatggaggatgaggcagtgaggagccgtgtgcagcacaag
cccaaggaggacaagctcaggctagcacaggagctctctgacatggtcatttactgcaag
agtgtccactttgggggcttctccagtcctggcacccctggacaggccttctacgagatg
gcgtccttctctgagaaccgtgcccttcgactgctccaagaatcaggaaacggctttgtc
cgccacaacgtggggcacctgagcagaatctacccggctggatggagaacagactcctcc
aactacagccccgtggagatgtggaatgggggctgccagatcgtggccctgaatttccag
acacctgggccagagatggacgtgtatcagggtcgcttccaggacaacggggcctgtggg
tacgtgctgaagcccgccttcctgcgagaccccaacggcacctttaacccccgcgccctg
gctcaggggccctggtgggcacggaagcggctcaacatcagggtcatttcggggcagcag
ctgccaaaagtcaacaagaataagaattcaattgtggaccccaaagtgacagtggagatc
catggcgtgagccgggacgtggccagccgccagactgctgtcatcaccaacaatggtttc
aacccatggtgggacacggagtttgcgtttgaggtagttgtgcctgaccttgccctcgtc
cgcttcttggtggaagattatgatgcctcctccaagaatgacttcattggccagagtacc
atccccttgaacagcctcaagcaaggataccgccatgtccacctcatgtctaagaacggg
gaccagcatccatcagccaccctctttgtgaagatctccctccaggactag

DBGET integrated database retrieval system