KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101140125Help
Entry
101140125         CDS       T02442                                 

Gene name
KAT7
Definition
histone acetyltransferase KAT7 isoform 1
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101140125 (KAT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 611 aa AA seqDB search
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR
NLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTAD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQ
DDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLEN
LTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYA
RLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQ
YMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEIS
IKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDP
SCLKWTPPKGT
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaaggaagaggaatgcaggcagtagttcagatggaaccgaagattccgatttt
tctacagatctcgagcacacagacagttcagaaagtgatggcacatcccgacgatctgct
cgagtcacccgctcctcagccaggctaagccagagttctcaagattccagtcctgttcga
aatctgcagtcttttggcactgaggagcctgcttactctaccagaagagtgacccgtagt
cagcagcagcctaccccagtgacaccgaaaaaataccctcttcggcagactcgttcatct
ggctcagaaactgagcaagtggttgatttttcagatagagaaactaaaaatacagctgat
catgatgagtcaccgcctcgaactccaactggaaatgcaccttcttctgagtctgacata
gacatctccagccccaatgtgtctcacgatgagagcattgccaaggacatgtccctgaag
gactcaggcagtgatctctctcatcgccccaagcgccgtcgcttccatgaaagctacaac
ttcaatatgaagtgtcctacaccaggctgtaactctctaggacaccttacaggaaaacat
gagagacatttctccatctcaggatgcccactctatcataacctctcagctgacgaatgc
aaggtgagagcacagagccgggataagcagatagaagaaaggatgctgtctcacaggcaa
gatgacaacaacaggcatgcaaccaggcaccaggcaccaacggagaggcagcttcgatat
aaggaaaaagtggctgaactcaggaagaaaagaaattctggactgagcaaagaacagaaa
gagaaatatatggaacacagacagacctatgggaacacacgggaacctcttctagaaaac
ctgacaagcgagtatgacttggatcttttccgaagagcacaagcccgggcttcagaggat
ttggagaagttaaggctgcaaggccaaatcacagagggaagcaacatgattaaaacaatt
gcttttggccgctatgagcttgatacctggtaccattctccatatcctgaagaatatgca
cggctgggacgtctctatatgtgtgaattctgtttaaaatacatgaagagccaaacgata
ctccgccggcacatggccaaatgtgtgtggaaacacccacctggtgatgagatatatcgc
aaaggttcaatctctgtgtttgaagtggatggcaagaaaaacaagatctactgccaaaac
ctgtgcctgttggccaaactttttctggaccacaagacattatattatgatgtggagccc
ttcctgttctatgttatgacagaggcggacaacactggctgtcacctgattggatatttt
tccaaggaaaagaattcattcctcaactacaacgtctcctgtatccttactatgcctcag
tacatgagacagggctatggcaagatgcttattgatttcagttatttgctttccaaagtc
gaagaaaaagttggctccccagaacgtccactctcagatctggggcttataagctatcgc
agttactggaaagaagtacttctccgctacctgcataatttccaaggcaaagagatttct
atcaaagaaatcagtcaggagacggctgtgaatcctgtggacattgtcagcactctgcaa
gcccttcagatgctcaagtactggaagggaaaacacctagttttaaagagacaggacctg
attgatgagtggatagccaaagaggccaaaaggtccaactccaataaaaccatggatccc
agctgcttaaaatggacccctcccaagggcacttaa

DBGET integrated database retrieval system