KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101140132Help
Entry
101140132         CDS       T02442                                 

Gene name
ALOX12
Definition
arachidonate 12-lipoxygenase, 12S-type
Orthology
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    101140132 (ALOX12)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    101140132 (ALOX12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101140132 (ALOX12)
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     101140132 (ALOX12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 663 aa AA seqDB search
MGRYRIRVATGAWLFSGSYNRVQLWLVGARGEAELELQLRPARGEEEEFDHDVAEDLGLL
QFVRLRKHHWLVDDAWFCDRITVQGPGACAEVAFPCYRWVQGEDILSLPEGTARLPGDNA
LDVFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFESTLKA
GALEMALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFGYQFLNGANPML
LRRSTSLPSRLVLPSGMEELRAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPL
VMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYH
LLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVST
GGGGHVQLLRRAAAQLTYCSLCPPDDLADRGLLGLPGALYARDALRLWEIIARYVEGIVH
LFYQRDDVVKGDPELQAWCQEITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCIFTCTAQH
AAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRR
QPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENS
VTI
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgggccgctaccgcatccgcgtggccaccggggcttggctcttctccgggtcgtacaac
cgcgtgcagctttggctggtcggggcgcgcggggaggcggagctggagctgcagctgcgg
ccggcgcggggcgaggaggaggagtttgatcatgacgttgcagaggacttggggctcctg
cagttcgtgaggctgcgcaagcaccactggctggtggacgacgcgtggttctgcgaccgc
atcacggtgcagggccctggagcctgcgcggaggtggccttcccgtgctaccgctgggtg
cagggcgaggacatcctgagcctgcccgagggcaccgcccgcctgccgggagacaatgct
ttggacgtgttccagaagcatcgagagaaggaactgaaagacagacagcagatctactgc
tgggccacctggaaggaagggttacccctgaccatcgctgcagaccgtaaggatgatcta
cctccaaatatgagattccatgaggagaagaggctggactttgaatcgacactgaaggca
ggggctctggagatggccctcaaacgtgtttacaccctcctgagctcctggaactgccta
gaagactttgatcagatcttctggggccagaagagtgccctggctgagaaggttcgccag
tgctggcaggatgatgagttgttcggctaccagttcctcaatggtgccaaccccatgctg
ttgagacgctcgacctctctgccctccaggctagtgctgccctcggggatggaagagctt
cgtgctcaactggagaaagaacttcagaatggttccctgtttgaagctgacttcatcctt
ctggatggaattccagccaacgtgatccgaggagagaagcaatacctggctgcccccctc
gttatgctgaagatggagcccaatgggaagctgcagcccatggtcatccagattcagcct
cccaaccccagctctccaaccccaacactgttcctgccctcagaccccccacttgcctgg
ctcctggcaaagtcctgggtccgaaattcagatttccaactgcacgagatccagtatcac
ttgctgaacacccatctggtggctgaggtcatcgctgtcgccaccatgcggtgcctccca
ggactgcaccccatcttcaagttcctgatcccccatatccgctacaccatggaaatcaac
acccgggcccggacccaactcatctcagatggaggaatttttgataaggcagtgagcaca
ggtggagggggccatgtacagttgctccgtcgggcggcagctcagctgacctactgctcc
ctctgtcctcctgacgacctggctgaccggggcctgctgggactcccaggtgctctctat
gcccgtgatgctttgcggctctgggagatcattgccaggtatgtggaggggatcgtccac
ctcttctaccaaagggatgacgtagtgaagggggaccctgagctgcaggcctggtgtcag
gagatcacagaggtggggctgtgccaggcccaggaccgaggtttccctgtctcctttcag
tcccagagtcaactctgccatttcctcaccatgtgcatcttcacgtgcactgcccagcat
gccgccatcaaccagggccagctggactggtatgcctgggtccctaatgctccatgcaca
atgcggatgcccccacccaccaccaaggaagatgtgaccatggccacagtgatggggtca
ctacctgatgtccggcaggcctgtcttcaaatggccatctcatggcatctgagtcgccgc
cagccagacatggtgcctctggggcatcacaaagaaaaatatttctcaggccccaagccc
aaagctgtgctaaaccaattccgaacagatttggaaaagctggaaaaggagattacagcc
cggaatgagcaacttgactggccctatgaatatctgaagcccagctgcatagagaacagt
gtcaccatctga

DBGET integrated database retrieval system