KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101140472Help
Entry
101140472         CDS       T02442                                 

Gene name
CLOCK
Definition
circadian locomoter output cycles protein kaput
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Circadian rhythm
Dopaminergic synapse
Herpes simplex infection
Class
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:ggo04728]
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:ggo04710]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:ggo05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 817 aa AA seqDB search
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKIEVTTLNHLSWTSLSLNA
TPTKIPTDTSTPPRQHLPAHEKMVQRRSSFSSQSINSQSVGSSLTQPVMSQATNLPIPQG
MSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQS
NPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQS
TSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSA
AVTTFTQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQSQT
LSVTQQQQQQQSSQEQQLTSVQQPSQAQLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQ
QSTFPQSHHQQHQSQQQQQLSRHRTDSLPDPSKVQPQ
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgtagtaaaatgagctcgattgttgacagagatgacagtagt
atttttgatgggttggtggaagaagatgacaaggacaaagcgaaaagagtatctagaaac
aaatctgaaaagaaacgtagagatcaatttaatgttctcattaaagaactgggatccatg
cttcctggtaatgctagaaagatggacaaatctactgttctgcagaaaagcattgatttt
ttacgaaaacataaagaaatcactgcacagtcagatgctagtgaaattcgacaggactgg
aaacctacattccttagtaatgaagagtttacacaattaatgttagaggctcttgatggt
ttttttttagcaatcatgacagatggaagcataatatatgtgtctgagagtgtaacttca
ttacttgaacatttaccatctgatcttgtggatcaaagtatatttaattttatcccagaa
ggggaacattcagaggtttataaaatactctctactcatctgctggaaagtgattcatta
accccagaatatttaaaatcaaaaaatcagttagaattctgttgtcatatgctgcgagga
acaatagacccaaaggagccatctacctatgaatatgtaaaatttataggaaatttcaaa
tctttaaacagtgtatcctcttcagcacacaatggttttgaaggaactatacaacgcaca
cataggccatcttatgaagatagagtttgttttgtagctactgtcaggttagctacacct
cagttcatcaaggaaatgtgcactgttgaagaacccaatgaagagtttacatctagacat
agtttagaatggaagtttctgtttctagatcacagggcaccacccataatagggtatttg
ccatttgaagttctgggaacatcaggctatgattactatcatgtggatgacctagaaaat
ttggcaaaatgtcatgagcacttaatgcaatatgggaaaggcaaatcatgttattatagg
ttcctgactaaggggcaacagtggatttggcttcagactcattattatatcacttaccat
cagtggaattcaaggccagagtttattgtttgtactcacactgtagtaagttatgcagaa
gttagggctgaaagacgacgagaacttggcattgaagagtctcttcctgagacagctgct
gacaaaatagaagtaactacattgaatcatctgtcatggacttcactttcattgaatgca
acaccaaccaagatcccgacggatacgagcactccgcccaggcagcatttaccagctcat
gagaagatggtgcaaagaaggtcatcatttagtagtcagtccataaattcccagtctgtt
ggttcatcgttaacacagccagtgatgtctcaagctacaaatttaccaattccacaaggc
atgtcccagtttcagttttcagctcaattaggagccatgcaacatctgaaagaccaattg
gaacaacggacacgcatgatagaagcaaatattcatcggcaacaagaagaactaagaaaa
attcaagaacaacttcagatggtccatggtcaggggctgcagatgtttttgcaacaatca
aatcctgggttgaattttggttccgttcaactttcttctggaaattcatctaacatccag
caacttgcacctataaatatgcaaggccaagttgttcctactaaccagattcaaagtgga
atgaatactggacacattggcacaactcagcacatgatacaacaacagactttacagagt
acatcaactcagagtcaacaaaatgtactgagtgggcacagtcagcaaacatctctaccc
agtcagacacagagcactcttacagccccactgtataacactatggtgatttctcagcct
gcagccggaagcatggtccagattccatctagtatgccacaaaacagcacccagagtgct
gcagtaactacattcactcaggacaggcagataagattttctcaaggtcaacaacttgtg
accaaattggtgactgctcctgtagcttgtggggcagtcatggtacctagtactatgctt
atgggccaggtggtgactgcatatcctacttttgctacacaacagcaacagtcacagaca
ttgtcagtaacgcagcagcagcagcagcagcagagctcccaggagcagcagctcacttca
gttcagcaaccatctcaggctcagctgacccagccaccgcaacaatttttacagacttct
aggttgctccatgggaatccctcaactcaactcattctctctgctgcatttcctctacaa
cagagcaccttccctcagtcacatcaccagcaacatcagtctcagcaacagcagcaactc
agccggcacaggactgacagcttgcccgacccttccaaggttcaaccacagtag

DBGET integrated database retrieval system