KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101140472Help
Entry
101140472         CDS       T02442                                 

Gene name
CLOCK
Definition
(RefSeq) clock circadian regulator
  KO
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Circadian rhythm
Dopaminergic synapse
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    101140472 (CLOCK)
  Environmental adaptation
   04710 Circadian rhythm
    101140472 (CLOCK)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101140472 (CLOCK)
Enzymes [BR:ggo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101140472 (CLOCK)
Transcription factors [BR:ggo03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101140472 (CLOCK)
Chromosome [BR:ggo03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101140472 (CLOCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
ENSGGOG00000005753
Position
4
AA seq 847 aa AA seqDB search
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMVQRRSSF
SSQSINSQSVGSSLTQPVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQ
VVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAP
LYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQIRFSQGQQLVTKLVTAPVAC
GAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQQSSQEQQLTSVQQPSQAQLT
QPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPD
PSKVQPQ
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgtagtaaaatgagctcgattgttgacagagatgacagtagt
atttttgatgggttggtggaagaagatgacaaggacaaagcgaaaagagtatctagaaac
aaatctgaaaagaaacgtagagatcaatttaatgttctcattaaagaactgggatccatg
cttcctggtaatgctagaaagatggacaaatctactgttctgcagaaaagcattgatttt
ttacgaaaacataaagaaatcactgcacagtcagatgctagtgaaattcgacaggactgg
aaacctacattccttagtaatgaagagtttacacaattaatgttagaggctcttgatggt
ttttttttagcaatcatgacagatggaagcataatatatgtgtctgagagtgtaacttca
ttacttgaacatttaccatctgatcttgtggatcaaagtatatttaattttatcccagaa
ggggaacattcagaggtttataaaatactctctactcatctgctggaaagtgattcatta
accccagaatatttaaaatcaaaaaatcagttagaattctgttgtcatatgctgcgagga
acaatagacccaaaggagccatctacctatgaatatgtaaaatttataggaaatttcaaa
tctttaaacagtgtatcctcttcagcacacaatggttttgaaggaactatacaacgcaca
cataggccatcttatgaagatagagtttgttttgtagctactgtcaggttagctacacct
cagttcatcaaggaaatgtgcactgttgaagaacccaatgaagagtttacatctagacat
agtttagaatggaagtttctgtttctagatcacagggcaccacccataatagggtatttg
ccatttgaagttctgggaacatcaggctatgattactatcatgtggatgacctagaaaat
ttggcaaaatgtcatgagcacttaatgcaatatgggaaaggcaaatcatgttattatagg
ttcctgactaaggggcaacagtggatttggcttcagactcattattatatcacttaccat
cagtggaattcaaggccagagtttattgtttgtactcacactgtagtaagttatgcagaa
gttagggctgaaagacgacgagaacttggcattgaagagtctcttcctgagacagctgct
gacaaaagccaagattctgggtcagataatcgcataaacacagtcagtctcaaggaagca
ttggaaaggtttgatcacagcccaaccccttctgcctcttctcggagttcaagaaaatca
tctcacacggccgtctcagacccttcctcaacaccaaccaagatcccgacggatacgagc
actccgcccaggcagcatttaccagctcatgagaagatggtgcaaagaaggtcatcattt
agtagtcagtccataaattcccagtctgttggttcatcgttaacacagccagtgatgtct
caagctacaaatttaccaattccacaaggcatgtcccagtttcagttttcagctcaatta
ggagccatgcaacatctgaaagaccaattggaacaacggacacgcatgatagaagcaaat
attcatcggcaacaagaagaactaagaaaaattcaagaacaacttcagatggtccatggt
caggggctgcagatgtttttgcaacaatcaaatcctgggttgaattttggttccgttcaa
ctttcttctggaaattcatctaacatccagcaacttgcacctataaatatgcaaggccaa
gttgttcctactaaccagattcaaagtggaatgaatactggacacattggcacaactcag
cacatgatacaacaacagactttacagagtacatcaactcagagtcaacaaaatgtactg
agtgggcacagtcagcaaacatctctacccagtcagacacagagcactcttacagcccca
ctgtataacactatggtgatttctcagcctgcagccggaagcatggtccagattccatct
agtatgccacaaaacagcacccagagtgctgcagtaactacattcactcaggacaggcag
ataagattttctcaaggtcaacaacttgtgaccaaattggtgactgctcctgtagcttgt
ggggcagtcatggtacctagtactatgcttatgggccaggtggtgactgcatatcctact
tttgctacacaacagcaacagtcacagacattgtcagtaacgcagcagcagcagcagcag
cagagctcccaggagcagcagctcacttcagttcagcaaccatctcaggctcagctgacc
cagccaccgcaacaatttttacagacttctaggttgctccatgggaatccctcaactcaa
ctcattctctctgctgcatttcctctacaacagagcaccttccctcagtcacatcaccag
caacatcagtctcagcaacagcagcaactcagccggcacaggactgacagcttgcccgac
ccttccaaggttcaaccacagtag

DBGET integrated database retrieval system