KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101140993Help
Entry
101140993         CDS       T02442                                 

Gene name
POMT2
Definition
protein O-mannosyl-transferase 2
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ggo00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 750 aa AA seqDB search
MPPATGGGLAESELRPRRGRCSPQAARAAGRDVAAEAVARSPKRPAWGSRRFEAAGWWAL
LALVTLLSFATRFHRLDEPPHICWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYL
SGYDGTFLFQKPGDKYEHHSYMGMRGFCAFLGSWLVPFAYLTVLDLSKSLSAALLTAALL
TFDTGCLTLSQYILLDPILMFFIMAAMLSMVKYNSCADRPFSAPWWFWLSLTGVSLAGAL
GVKFVGLFIILQVGLNTIADLWYLFGDLSLSLVTVGKHLTARVLCLIVLPLALYTATFAV
HFMVLSKSGPGDGFFSSAFQARLSGNNLHNASIPEHLAYGSVITVKNLRMAIGYLHSHRH
LYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNSDPLDPSFPVEFVRHGDIIRLEHKETS
RNLHSHYHEAPMTRKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLV
TGCVLGSSGKVLPKWGWEQLEVTCTPYLKETLNSIWNVEDHINPKLPNISLDVLQPSFPE
ILLESHMVMIRGNSGLKPKDNEFTSKPWHWPINYQGLRFSGVNDTDFRVYLLGNPVVWWL
NLLSIALYLLSGSIIAVAMQRGARLPAEVAGLSQVLLRGGGQVLLGWTLHYFPFFLMGRV
LYFHHYFPAMLFSSMLTGILWDTLLRLCAWGLASWPLARGIHVAGILSLLLGTAYSFYLF
HPLAYGMVGPLAQDPQSPMAGLRWLDSWDF
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggccacgggcggaggcctggcagagtccgagctgcgtccccggaggggccgc
tgtagcccccaggctgctagggccgcaggccgggacgtggccgctgaggctgtggcgcga
agccccaaacggcctgcttggggctcacggcgcttcgaggcggccggctggtgggccctg
ctggccttggtgacgctgctgtccttcgccacccgcttccaccgcttggacgagccgccg
cacatctgttgggatgagactcactttggaaaaatgggaagttactatatcaaccgtaca
tttttctttgatgtgcacccgcccctgggaaagatgctgataggtcttgctggctacctg
agtggatatgatggtacctttttgttccagaagcctggggataaatatgagcatcacagc
tacatgggaatgagaggattctgtgcattcctcggctcctggctggtcccctttgcctac
ctcactgtactggatctgtccaagtccctctcggcagcactgctcacagctgccctcctc
acctttgacacgggatgcctcactctgtcccagtacatcctccttgaccccatcctgatg
ttcttcatcatggctgccatgctgagcatggtcaagtacaactcttgcgccgacaggccc
ttctctgccccctggtggttctggctcagcctgactggcgttagtcttgctggtgcttta
ggggtcaagtttgttggcctctttatcatccttcaagtggggctgaacaccattgcagac
ctttggtacctgttcggagacctcagtctttcattggtgactgtgggaaaacacctgact
gctcgtgtcctgtgcctcatagtgctgcccctggctctctatacagccacctttgctgtt
cacttcatggtgctgagtaaaagtggccctggtgatggtttcttcagttctgccttccag
gcccggctttcagggaacaacctgcacaatgcttccatccctgaacacctggcctacggc
tctgtgatcactgtgaagaacctccggatggccatcggctatctgcactcccacaggcac
ctgtaccccgagggcattggtgcccgtcagcagcaggtcaccacctatttgcacaaggac
tacaacaacctgtggattatcaagaaacataacacaaactcagatcccctagacccttcc
ttcccagtggagtttgtaagacatggagacattattcgactagaacacaaagaaacttcc
cggaacttgcacagtcactatcatgaggcccccatgacccggaagcactatcaggtcacc
ggctatggcataaatggaacaggggactcaaatgatttctggcggattgaggtcgtaaac
agaaaatttggaaaccggatcaaagtgctgagaagtcgaattcgcttcatccatttggtc
acaggttgtgtcctgggctcctcgggaaaggttctgcccaagtggggctgggagcagttg
gaagttacttgcaccccatacctgaaagaaaccctcaactccatctggaatgtggaggac
catatcaatcccaagttgccaaacatcagcctggatgtgctgcagcccagttttcctgag
atcttgctggaatcccacatggtcatgatccgggggaacagtggcctcaaacccaaggac
aatgagttcacgtccaaaccctggcactggcctatcaactatcagggcctacgcttctca
ggggtcaatgacacagatttccgagtctatctgcttggcaatccggtggtttggtggctg
aatctgttgagcatcgccctctacctcctctcagggagcatcattgctgtagccatgcag
agaggggcacggctgccagcggaggttgcagggttgtcccaggtcctgctgcgaggaggc
ggccaggtcctgctcggctggacactccattacttcccgtttttcctgatgggccgggtc
ctctacttccaccactacttcccagccatgctcttctcaagcatgttgacaggcattctg
tgggacaccctcctgcggctctgtgcctggggcttggcctcatggcccctggcgaggggc
atacatgtggcgggaatcctgagcctgctcctgggaaccgcctacagcttctacctcttc
caccctctggcttatgggatggttggtcccctggcccaggacccccaaagtccaatggca
ggactaaggtggctggactcatgggacttttga

DBGET integrated database retrieval system