KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101141938Help
Entry
101141938         CDS       T02442                                 

Definition
LOW QUALITY PROTEIN: chymosin-like
Orthology
K01378  
chymosin [EC:3.4.23.4]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.4  chymosin
     101141938
Peptidases [BR:ggo01002]
 Aspartic Peptidases
  Family A1: pepsin family
   101141938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 381 aa AA seqDB search
MRGLVVFLAVFALSEVNAITRVPLHKGKSLRRALKERRLLEDFLRNHHYAVSRKHSSSGV
VASESLTNYLDCQYFGKIYIGSPPQKFTLVFDTGSLDLWVPSVYCNSDACQNHQRFDPSK
SSTXQNMGKSLSIQYGTGSMRGLLGYDTVTVSNIVDPHQTVGLSTEEPGDIFTYSEFDGI
LGLAYPSLASEXSVPVFDNTMPRHLVAQDLFSVYMSRNDQGSMLTLRAIDLSYYTGSLHW
IPMTXQEYWQFTVDSVIIDGMVVVCDGGCQAILDTGTSLLVGPGSNILNIQQAIGATAGQ
YNEFDIDCGRLSSMPTVVFEIHGKKYPLPPSAYTSQDQGFCTSGFQGDYSSQQWILGGVF
TREYYSVFDRANNCVGLAKAV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaggggccttgtggtgttccttgcagtctttgctctctctgaggtcaatgccatcacc
agggttcctctgcacaaagggaagtcgctgaggagggccctgaaggagcgcaggctcctg
gaggacttcctgaggaatcaccattatgcagtcagcaggaagcactccagctctggggtg
gtggccagcgagtctctgaccaactacctggattgtcagtactttgggaagatctacatc
gggtcccctccccagaagttcaccttggtgtttgatacaggctccctggatctctgggtg
ccctctgtctactgcaacagtgatgcctgtcaaaaccaccaacgcttcgatccgtccaag
tcctccaccncacagaacatgggcaagtccctgtccatccagtatggcacaggcagcatg
cggggcttgctgggctatgacactgtcaccgtctccaacattgtggacccccaccagact
gtgggcctgagcaccgaggaacctggcgacatcttcacctactccgagtttgatgggatc
ctggggctggcctatccctctcttgcctctgagtagtcagtgccagtgtttgacaacacg
atgccgaggcacctggtggcccaagacctgttctcagtctacatgagcaggaatgaccag
gggagcatgctcacactgagggccattgacctgtcctactacacaggctccctgcactgg
atacccatgactnngcaagaatactggcagttcactgtggacagtgtcatcattgatggc
atggtggtggtctgtgacggtggctgtcaggccatcctggacaccggcacctccctgctg
gtggggcctggcagcaacatcctcaacatccagcaggccattggagccactgcgggccag
tacaatgagtttgacatcgactgcgggcgcctgagcagcatgcccacggttgtcttcgag
atccacggcaagaagtaccccctgccaccctccgcctacaccagccaggaccagggcttc
tgcaccagtggtttccagggtgactatagttcccagcagtggatcctagggggtgtcttc
acccgggagtattacagtgtctttgacagggccaataactgtgtggggctggcgaaggct
gtctga

DBGET integrated database retrieval system