KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101142824Help
Entry
101142824         CDS       T02442                                 

Gene name
HDAC4
Definition
histone deacetylase 4
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Alcoholism
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101142824 (HDAC4)
  Substance dependence
   05034 Alcoholism
    101142824 (HDAC4)
  Infectious diseases
   05169 Epstein-Barr virus infection
    101142824 (HDAC4)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101142824 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2B
AA seq 1084 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP
SSPNNSSGSVSAENGIAPTVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPA
TGPSAGTAGQQDAERLALPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL
EQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHL
VIQQQHQQFLEKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPY
LDRLPGQKEAHAPAGVQVKQEPIESDDEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQ
RIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEPPTKPRFTTGLVYDT
LMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHT
LLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVE
LVFKVTTGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWD
VHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGXXPQVGTGPGVGFNVNMAFTGGLDP
PMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQL
MGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKV
MEIHSKYWRCLQRTASTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDEEPMEE
EPPL
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aatcctgcccgcgtgaaccacatgcccagcacggtggatgtggccacggcgctgcctctg
caagtggccccctcggcagtgcccatggacctgcgcctggaccaccagttctcactgcct
gtggcagagccggccctgcgggagcagcagctgcagcaggagctcctggcgctcaagcag
aagcagcagatccagaggcagatcctcatcgccgagttccagaggcagcacgagcagctc
tcccggcagcacgaggcgcagctccacgagcacatcaagcaacagcaggagatgctggcc
atgaagcaccagcaggagctgctggaacaccagcggaagctggagaggcaccgccaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaag
ggcaaagagagtgccgtggccagcacagaagtgaagatgaagttacaagaatttgtcctc
aataaaaagaaggcgctggcccaccggaatctgaaccactgcatttccagcgaccctcgc
tactggtacgggaaaacgcagcacagttcccttgaccagagttctccaccccagagcgga
gtgtcgacctcctataaccacccggtcctgggaatgtacgacgccaaagatgacttccct
cttaggaaaacagcttctgaaccgaatctgaaattacggtccaggctaaagcagaaagtg
gccgaaagacggagcagccccctgttacgcaggaaagacgggccagtggtcactgctcta
aaaaagcgtccgttggatgtcacagactccgcgtgcagcagcgccccaggctccggaccc
agctcacccaacaacagctctgggagcgtcagcgcagagaacggtatcgcgcccaccgtc
cccagcatcccggcggagacgagtttggcgcacagacttgtggcacgagaaggctcggcc
gctccacttcccctctacacgtcgccatccctgcccaacatcacgctgggcctgcctgcc
accggcccttctgctggcacggcgggccagcaggacgccgagagactcgcccttcccgcc
ctccagcagaggctctcccttttccccggcacccacctcactccctacctgagcacctcg
cccttggagcgggatggaggggcagcgcacagccctcttctgcagcacatggtcttactg
gagcagccgccggcacaagcgcccctcgtcacaggcctgggagcactgcccctccacgca
cagtccttggttggtgcagaccgggtgtccccctccatccacaagctgcggcagcaccgc
ccactggggcggacccagtcggccccgctgccccagaacgcccaggctctgcagcacctg
gtcatccagcagcagcatcagcagtttctggagaaacacaagcagcagttccagcagcag
caactgcagatgaacaagatcatccccaagccaagcgagccagcccggcagccggagagc
cacccggaggagacggaggaggagctccgtgagcaccaggctctgctggacgagccctac
ctggaccggctgccggggcagaaggaggcgcacgcaccggccggcgtgcaggtgaagcag
gagcccattgagagcgatgacgaagaggcggagcccccgcgggaggtggagccgggccag
cgccagcccagtgagcaggagctgctcttcagacagcaagccctcctgctggagcagcag
cggatccaccagctgaggaactaccaggcgtccatggaagccgccggcatccccgtgtcc
ttcggcggccacaggcctctgtcccgggcgcagtcctcacccgcatctgccaccttcccc
gtgtctgtgcaggagccccccaccaagccgaggttcacgacaggcctcgtgtatgacacg
ctgatgctgaagcaccagtgcacctgcgggagcagcagcagccaccccgagcacgccggg
aggatccagagcatctggtcccgcctgcaggagacgggcctccggggcaaatgcgagtgc
atccgcggacgcaaggccaccctggaggaactacagacggtgcactcggaagcccacacc
ctcctgtatggcacgaaccccctcaaccggcagaaactggacagtaagaaacttctaggc
tcgctcgcctccgtgttcgtccggctcccctgcggtggtgttggggtggacagtgacacc
atatggaacgaggtgcactcggcgggggcggcccgcctggctgtgggctgcgtggtagag
ctggtcttcaaggtgaccacgggggagctgaagaatggctttgctgtggtccgcccccct
ggacaccacgcggaggagagcacgcccatgggcttttgctacttcaactccgtggccgtg
gcagccaagcttctgcagcagaggttgagcgtgagcaagatcctcatcgtggactgggac
gtgcaccatggaaacgggacccagcaggctttctacagcgaccccagcgtcctgtacatg
tccctccaccgctatgacgatgggaacttcttcccaggcagcgggnnnnggccacaggtg
ggcacagggcccggcgtgggtttcaacgtcaacatggctttcaccggcggcctggacccc
cccatgggagacgctgagtacttggcagccttcagaacggtggtcatgccaatcgccagc
gagtttgccccggacgtggtgctggtgtcatcaggcttcgacgccgtggagggccacccc
acccctcttgggggctacaacctctccgccagatgcttcgggtacctgacgaagcagctg
atgggcctggctggcggccggatcgtcctggccctcgagggaggccacgacctgaccgcc
atttgcgacgcctcggaagcatgtgtttctgccttgctgggaaacgagcttgatcctctc
ccagaaaaggttttacagcaaagacccaatgcaaacgctgtccgctccatggagaaagtc
atggagatccacagcaagtactggcgctgcctgcagcgcacagcctccacagcggggcgt
tctctgatcgaggctcagacttgcgagaacgaagaagccgagacggtcaccgccatggcc
tcgctgtccgtgggcgtgaagcccgccgaaaagagaccagatgaggagcccatggaagag
gagccgcccctgtag

DBGET integrated database retrieval system