KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101142824Help
Entry
101142824         CDS       T02442                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Apelin signaling pathway
Alcoholism
Human papillomavirus infection
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    101142824 (HDAC4)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101142824 (HDAC4)
  Substance dependence
   05034 Alcoholism
    101142824 (HDAC4)
  Infectious diseases
   05169 Epstein-Barr virus infection
    101142824 (HDAC4)
   05165 Human papillomavirus infection
    101142824 (HDAC4)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101142824 (HDAC4)
Chromosome [BR:ggo03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101142824 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
2B
AA seq 1098 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESLIFASGFESAVASTEV
KMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLG
MYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSA
CSSAPGSGPSSPNNSSGSVSAENGIAPTVPSIPAETSLAHRLVAREGSAAPLPLYTSPSL
PNITLGLPATGPSAGTAGQQDAERLALPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHS
PLLQHMVLLEQPPAQAPLVTDWYLSGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQ
SAPLPQNAQALQHLVIQQQHQQFLEKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETE
EELREHQALLDEPYLDRLPGQKEAHAPAGVQVKQEPIESDDEEAEPPREVEPGQRQPSEQ
ELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEP
PTKPRFTTGLVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKA
TLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVH
SAGAARLAVGCVVELVFKVTTGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQ
QRLSVSKILIVDWDVHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGV
GFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGY
NLSARCFGYLTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQ
QRPNANAVRSMEKVMEIHSKYWRCLQRTASTAGRSLIEAQTCENEEAETVTAMASLSVGV
KPAEKRPDEEPMEEEPPL
NT seq 3297 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aatcctgcccgcgtgaaccacatgcccagcacggtggatgtggccacggcgctgcctctg
caagtggccccctcggcagtgcccatggacctgcgcctggaccaccagttctcactgcct
gtggcagagccggccctgcgggagcagcagctgcagcaggagctcctggcgctcaagcag
aagcagcagatccagaggcagatcctcatcgccgagttccagaggcagcacgagcagctc
tcccggcagcacgaggcgcagctccacgagcacatcaagcaacagcaggagatgctggcc
atgaagcaccagcaggagctgctggaacaccagcggaagctggagaggcaccgccaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaag
ggcaaagagagtctaatttttgcatcaggatttgaaagtgccgtggccagcacagaagtg
aagatgaagttacaagaatttgtcctcaataaaaagaaggcgctggcccaccggaatctg
aaccactgcatttccagcgaccctcgctactggtacgggaaaacgcagcacagttccctt
gaccagagttctccaccccagagcggagtgtcgacctcctataaccacccggtcctggga
atgtacgacgccaaagatgacttccctcttaggaaaacagcttctgaaccgaatctgaaa
ttacggtccaggctaaagcagaaagtggccgaaagacggagcagccccctgttacgcagg
aaagacgggccagtggtcactgctctaaaaaagcgtccgttggatgtcacagactccgca
tgcagcagcgccccaggctccggacccagctcacccaacaacagctctgggagcgtcagc
gcagagaacggtatcgcgcccaccgtccccagcatcccggcggagacgagtttggcgcac
agacttgtggcacgagaaggctcggccgctccacttcccctctacacgtcgccatccctg
cccaacatcacgctgggcctgcctgccaccggcccttctgctggcacggcgggccagcag
gacgccgagagactcgcccttcccgccctccagcagaggctctcccttttccccggcacc
cacctcactccctacctgagcacctcgcccttggagcgggatggaggggcagcgcacagc
cctcttctgcagcacatggtcttactggagcagccgccggcacaagcgcccctcgtcaca
gactggtatctttcaggcctgggagcactgcccctccacgcacagtccttggttggtgca
gaccgggtgtccccctccatccacaagctgcggcagcaccgcccactggggcggacccag
tcggccccgctgccccagaacgcccaggctctgcagcacctggtcatccagcagcagcat
cagcagtttctggagaaacacaagcagcagttccagcagcagcaactacagatgaacaag
atcatccccaagccaagcgagccagcccggcagccggagagccacccggaggagacggag
gaggagctccgtgagcaccaggctctgctggacgagccctacctggaccggctgccgggg
cagaaggaggcgcacgcaccggccggcgtgcaggtgaagcaggagcccattgagagcgat
gacgaagaggcggagcccccgcgggaggtggagccgggccagcgccagcccagtgagcag
gagctgctcttcagacagcaagccctcctgctggagcagcagcggatccaccagctgagg
aactaccaggcgtccatggaagccgccggcatccccgtgtccttcggcggccacaggcct
ctgtcccgggcgcagtcctcacccgcgtctgccaccttccccgtgtctgtgcaggagccc
cccaccaagccgaggttcacgacaggcctcgtgtatgacacgctgatgctgaagcaccag
tgcacctgcgggagcagcagcagccaccccgagcacgccgggaggatccagagcatctgg
tcccgcctgcaggagacgggcctccggggcaaatgcgagtgcatccgcggacgcaaggcc
accctggaggaactacagacggtgcactcggaagcccacaccctcctgtatggcacgaac
cccctcaaccggcagaaactggacagtaagaaacttctaggctcgctcgcctccgtgttc
gtccggctcccctgcggtggtgttggggtggacagtgacaccatatggaacgaggtgcac
tcggcgggggcggcccgcctggctgtgggctgcgtggtagagctggtcttcaaggtgacc
acgggggagctgaagaatggctttgctgtggtccgcccccctggacaccacgcggaggag
agcacgcccatgggcttttgctacttcaactccgtggccgtggcagccaagcttctgcag
cagaggttgagcgtgagcaagatcctcatcgtggactgggacgtgcaccatggaaacggg
acccagcaggctttctacagcgaccccagcgtcctgtacatgtccctccaccgctatgat
gatgggaacttcttcccaggcagcggggctcctgatgaggtgggcacagggcccggcgtg
ggtttcaacgtcaacatggctttcaccggcggcctggacccccccatgggagacgctgag
tacttggcagccttcagaacggtggtcatgccaatcgccagcgagtttgccccggacgtg
gtgctggtgtcatcaggcttcgacgccgtagagggccaccccacccctcttgggggctac
aacctctccgccagatgcttcgggtacctgacgaagcagctgatgggcctggctggcggc
cggatcgtcctggccctcgagggaggccacgacctgaccgccatttgcgacgcctcggaa
gcatgtgtttctgccttgctgggaaacgagcttgatcctctcccagaaaaggttttacag
caaagacccaatgcaaacgctgtccgctccatggagaaagtcatggagatccacagcaag
tactggcgctgcctgcagcgcacagcctccacagcggggcgttctctgatcgaggctcag
acttgcgagaacgaagaagccgagacggtcaccgccatggcctcgctgtccgtgggcgtg
aagcccgccgaaaagagaccagatgaggagcccatggaagaggagccgcccctgtag

DBGET integrated database retrieval system