KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101142984Help
Entry
101142984         CDS       T02442                                 

Gene name
PLCD3
Definition
(RefSeq) phospholipase C delta 3
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101142984 (PLCD3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101142984 (PLCD3)
   04070 Phosphatidylinositol signaling system
    101142984 (PLCD3)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101142984 (PLCD3)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101142984 (PLCD3)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101142984 (PLCD3)
Membrane trafficking [BR:ggo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101142984 (PLCD3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101142984 (PLCD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
ENSGGOG00000014717
Position
5
AA seq 820 aa AA seqDB search
MSLPDPGHRLQKRCHLDVPHFAHALWRLLTIGEEGSPARGREAYCGAKAWVWRGWRKGQQ
VLAGEGRGASGQGRPDAPGPPAPAGLTEDEDVRAMLRGSRLRKIRSRTWHKERLYRLQED
GLSVWFQRRIPRAPSQHIFFVQHIEAVREGHQSEGLRRFGGAFAPARCLTIAFKGRRKNL
DLAAPTAEEAQRWVRGLTKLRARLDAMSQRERLDHWIHSYLHRADSNQDSKMSFKEIKSL
LRMVNVDMNDMYAYLLFKECDHSNNDRLEGAEIEEFLRQLLKRPELEEIFHQYSGEDRVL
SAPELLEFLEDQGEEGATLARAQQLIQTYELNETAKQHELMTLDGFMMYLLSPEGAALDN
THTCVFQDMNQPLAHYFISSSHNTYLTDSQIGGPSSTEAYVRAFAQGCRCVELDCWEGPG
GEPVIYHGHTLTSKILFRDVVQAVRDHAFTLSPYPVILSLENHCGLEQQAAMAHHLCTIL
GDMLVTQALDSPNPEELPSPEQLKGRVLVKGKKLPAARSEDGRALSDREEEEEEDDEEEE
EEVEAAVQRRLAKQISPELSALAVYCHATRLRTLHPAPNALQPCQVSSLSERKAKKLIRE
AGNSFVRHNARQLTRVYPLGLRMNSANYSPQEMWNSGCQLVALNFQTPGYEMDLNAGRFL
VNGQCGYVLKPACLRQPDSTFDPEYPGPPRTTLSIQVLTAQQLPKLNAEKPHSIVDPLVR
VEIHGVPADCARQETDYVLNNGFNPRWGQTLQFQLRAPELALVRFVVEDYDATSPNDFVG
QFTLPLSSLKQGYRHIHLLSKDGASLSPATLFIQIRIQRS
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgccggacccaggccaccggctgcagaaacgctgccacctggacgtcccccac
ttcgcgcacgcactctggaggcttcttacaatcggggaggaggggagtcctgcgaggggg
agggaagcttactgtggggcgaaggcctgggtttggagaggctggaggaaggggcagcag
gtcctagcgggggagggcaggggagcctctgggcagggacggcctgacgccccgggtcct
cccgccccggcaggcctgacggaggacgaggacgtgcgcgccatgctgcggggctcccgg
ctccgcaagatccgctcgcgcacgtggcacaaggagcggctgtaccggctgcaggaggac
ggcctgagtgtgtggttccagcggcgcatcccgcgtgcgccatcgcagcacatcttcttc
gtgcagcacatcgaggcggtccgcgagggccaccagtccgagggcctgcggcgcttcggg
ggcgccttcgcgccggcgcgctgcctcaccatcgccttcaagggccgccgcaagaacctg
gacctggcggcgcccacggctgaggaagcgcagcgctgggtgcgcggtctgaccaagctc
cgcgcgcgcctggacgccatgagccagcgcgagcggctagaccactggatccactcctat
ctgcaccgggctgactccaaccaggacagcaagatgagtttcaaggagatcaagagcctg
ctgagaatggtcaacgtggacatgaacgacatgtacgcctacctcctcttcaaggagtgt
gaccactccaacaacgaccgtctagagggggctgagatcgaggagttcctgcggcagctg
ctgaagcggccggagctggaggagatcttccatcagtactcgggcgaggaccgcgtgctg
agtgcccccgagctgctggagttcctggaggaccagggcgaggagggcgccacactggcc
cgcgcccagcagctcattcagacctatgagctcaacgagacagccaagcagcatgagctg
atgacactggatggcttcatgatgtacctgttgtcgccggagggggctgccttggacaac
acccacacgtgtgtgttccaggacatgaaccagcccctcgcccactacttcatctcttcc
tcccacaacacctatctgactgactcccagatcggggggcccagcagcaccgaggcctac
gttagggcctttgcccagggatgccgctgcgtggagctggactgctgggaggggccagga
ggggagcccgtcatctatcatggccataccctcacctccaagattctcttccgggacgtg
gtccaagccgtgcgcgaccatgccttcacgctgtccccttaccctgtcatcctatccctg
gagaaccactgcgggctggagcagcaggctgccatggcccaccacctctgcaccatcctg
ggggacatgctggtgacacaggcgctggactccccaaatcccgaggagctgccatcccca
gagcagctaaagggccgggtcctggtgaagggaaagaagctgcccgctgctcggagcgag
gatggccgggctctgtcagatcgggaggaggaggaggaggaggatgacgaggaggaagaa
gaggaggtggaggctgcagtgcagaggcggctggccaagcagatctccccggagctgtcg
gccctggctgtgtactgccacgccacccgcctgcggaccctgcaccctgcccccaacgcc
ctgcaaccctgccaggtcagctccctcagcgagcgcaaagccaagaaactcattcgggag
gcagggaacagctttgtcaggcacaatgcccgccagctgacccgcgtgtacccgctgggg
ctgcggatgaactcagccaactacagtccccaggagatgtggaactcgggctgtcagctg
gtggccttgaacttccagacgccaggctacgagatggacctcaatgccgggcgcttccta
gtcaatgggcagtgtggctatgtcctaaaacctgcctgcctgcggcaacctgactcgacc
tttgaccctgagtacccgggacctcccagaaccactctcagcatccaggtgctgactgca
cagcagctgcccaagctgaatgccgagaagccacactccattgtggaccccctggtgcgc
gttgagatccatggggtgcccgcagactgtgcccggcaggagactgactacgtgctcaac
aatggcttcaacccccgctgggggcagaccctgcagttccagctgcgggctccggagctg
gcactggtccggtttgtggtggaagattatgacgccacctcccccaatgactttgtgggc
cagtttacactgcctcttagcagcctaaagcaagggtaccgccacatacacctgctttcc
aaggacggggcctcactgtcaccagccacgctcttcatccaaatccgcatccagcgctcc
tga

DBGET integrated database retrieval system