KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101143172Help
Entry
101143172         CDS       T02442                                 

Gene name
NCOA1
Definition
nuclear receptor coactivator 1 isoform 1
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101143172 (NCOA1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101143172 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2A
AA seq 1399 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINR
QQSSDLHSSSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTG
ISLAQFMSPRRQVTSGLATRPRMPNNSFPPNISTLSSPVGMTSSACNNNNRSYSNIPVTS
LQGMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDN
SSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSC
TGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVS
VTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ
MDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAV
TSVTIKSEILPASLQSATARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAIN
QSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDVLSERFPPQQATPPLIMEERPNLYSQPYSSPSPTTNLPSPFQGMVRQKPSLGT
MPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
AATAPVGISMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSF
GNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLAN
RNSMVSRGMTGNMGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPI
PPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVS
MAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTE
ADGTQDKKTEEFFSVVTTD
NT seq 4200 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcggggacagttcatccgaccctgctaacccagactcacataagaggaaa
ggatcgccatgtgacacactggcatcaagcactgaaaagaggcgcagggagcaagaaaat
aaatatttagaagaactagctgagttactgtctgccaacattagtgacattgacagcttg
agtgtaaaaccagacaaatgcaagattttgaagaaaacagtcgatcagatacagctaatg
aagagaatggaacaagagaaatcaacaactgatgacgatgtacagaaatcagacatctca
tcaagtagtcaaggagtgatagaaaaggaatccttgggacctcttcttttggaggctttg
gatggatttttctttgttgtgaactgtgaagggagaattgtatttgtgtcagagaatgta
accagctacttaggttacaatcaggaggaattaatgaataccagcgtctacagcatactg
cacgtgggggatcatgcagaatttgtgaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaagaggcaacacgacgaaatagccatacctttaactgcaggatgcta
attcaccctccagatgagccagggaccgagaaccaagaagcttgccagcgttatgaagta
atgcagtgtttcactgtgtcacagccaaaatcaattcaagaggatggagaagatttccag
tcatgtctgatttgtattgcacggcgattacctcggcctccagctattacgggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgatactagttccctg
agagctgctggcagaactggttgggaagatttagtgaggaagtgcatttatgcttttttc
caacctcagggcagagaaccatcttatgccagacagctgttccaagaagtgatgactcgt
ggcactgcctccagcccctcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcaacctttcatcatggga
attcatatcatcgacagggagcacagtgggctttctcctcaagatgacactaattctgga
atgtcaattccccgagtaaatccctcggtcaatcctagtatctctccagctcatggtgtg
gctcgttcatccacattgccaccatccaacagcaacatggtatccaccagaataaaccgc
cagcagagctcagaccttcatagcagcagtcatagtaattctagcaacagccaaggaagt
ttcggatgctcacccggaagtcagattgtagccaatgttgccttaaaccaaggacaggcc
agttcacagagcagtaatccctctttaaacctcaataattctcctatggaaggtacagga
atatccctagcacagttcatgtctccaaggagacaggttacttctggattggcaacaagg
cccaggatgccaaacaattcctttcctcctaatatttcgacattaagctctcccgttggc
atgacaagtagtgcctgtaataataataaccgatcttattcaaacatcccagtaacatct
ttacagggtatgaatgaaggacccaataactccgttggcttctctgccagttctccagtc
ctcaggcagatgagctcacagaattcacctagcagattaaatatacaaccagcaaaagct
gagtccaaagataacaaagagattgcctcaattttaaatgaaatgattcaatctgacaac
agctctagtgatggcaaacctctggattcagggcttctgcataacaatgacagactttca
gatggagacagtaaatactctcaaaccagtcacaaactagtgcagcttttgacaacaact
gccgaacagcagttacggcatgctgatatagacacaagctgcaaagatgtcctgtcttgc
acaggcacttccaactctgcctctgctaactcttcaggaggttcttgtccctcttctcat
agctcattgacggagcggcataaaattctacaccggctcttacaggagggtagcccctca
gatatcaccactttgtctgtcgagcctgataaaaaggacagtgcatctacttctgtgtca
gtgactggacaggtacaaggaaactccagtataaaactagaactggatgcttcaaagaaa
aaagaatcaaaagaccatcagctcctacgctatcttttagataaagatgagaaagattta
agatcaactccaaacctgagcctggatgatgtaaaggtgaaagtggaaaagaaagaacag
atggatccatgtaatacaaacccaaccccaatgaccaaacccactcctgaggaaataaaa
ctggaggcccagagccagtttacagctgaccttgaccagtttgatcagttactgcccacg
ctggagaaggcagcacagttgccaggcttatgtgagacagacaggatggatggtgcggtc
accagtgtaaccatcaaatcggagatcctgccagcttcacttcagtccgccactgccaga
cccacttccaggctaaatagattacctgagctggaattggaagcaattgataaccaattt
ggacaaccaggaacaggcgatcagattccatggacaaataatacagtgacagctataaat
cagagtaaatcagaagaccagtgtattagctcacaattagatgagcttctctgtccaccc
acaacagtagaagggagaaatgatgagaaggctcttcttgaacagctggtatccttcctt
agtggcaaagatgaaactgagctagctgaactagacagagctctgggaattgacaaactt
gttcaggggggtggattagatgtattatcagagagatttccaccacaacaagcaacgcca
cctttgatcatggaagaaagacccaacctttattcccagccttactcttctccttctcct
actaccaatctccctagccctttccaaggcatggtcaggcaaaaaccttcactggggacg
atgcctgttcaagtaacacctccccgaggtgctttttcacctggcatgggcatgcagccc
aggcaaactctaaacagacctccggctgcacctaaccagcttcgacttcaactacagcag
cgattacagggacaacagcagttgatacaccaaaatcggcaagctatcttaaaccagttt
gcagcaactgctcctgttggcatcagtatgagatcaggcatgcaacaacaaattacacct
cagccacccctgaatgctcaaatgttggcacaacgtcagcgggaactgtacagtcaacag
caccgacagaggcagctaatacagcagcaaagagccatgcttatgaggcaacaaagcttt
gggaacaacctccctccctcatctggactaccagttcaaatggggaacccccgtcttcct
cagggtgctccacagcaattcccctatccaccaaactatggtacaaatccaggaacccca
cctgcttctaccagcccgttttcacaactagcagcaaatcctgaagcatccttggccaac
cgcaacagcatggtgagcagaggcatgacaggaaacatgggaggacagtttggcactgga
atcaatcctcagatgcagcagaatgtcttccagtatccaggagcaggaatggttccccaa
ggtgaggccaactttgctccatctctaagccctgggagctccatggtgccgatgccaatc
cctcctcctcagagttctctgctccagcaaactccacctgcctctgggtatcagtcacca
gacatgaaggcctggcagcaaggagcgataggaaacaacaatgtgttcagtcaagctgtc
cagaaccagcccacgcctgcacagccaggagtatacaacaacatgagcatcaccgtttcc
atggcaggtggaaatacgaatgttcagaacatgaacccaatgatggcccagatgcagatg
agctctttgcagatgccaggaatgaacactgtgtgccctgagcagataaatgatcctgca
ctgagacacacaggcctctactgcaaccagctctcatccactgaccttctcaaaacagaa
gcagatggaacccaggacaagaagacagaagagttcttctctgtggtgactacagactag

DBGET integrated database retrieval system