KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101143341Help
Entry
101143341         CDS       T02442                                 

Gene name
CES3
Definition
LOW QUALITY PROTEIN: carboxylesterase 3
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     101143341 (CES3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 571 aa AA seqDB search
METAVRVESGVLVGVVCLLLACPATATGPEVAQPEVDTTLGRVRGRQVGVKGTDRLVNVF
LGIPFAQPPLGPNRFSGPRPAQPWEGVRDASTAPPMCLQDVESMNNSRFVLNGKQQIFSV
SEDCLVLNIYSPAEAPAGSGRPVMVWVHGGALITGTATSYNGSALAAYGDVVVVTVQYRL
GVLGFFSTGDEHAPGNQGFLDVVAALHWVQGNITPFGGDLNCVTVFGGSAGGSIISGLIL
SPVAAGLFHRAITQSGVITTPGIIDSHPWPLAQKIANTLACSSSSPAEMVQCLRQKEGEE
LVLSKKLKTTVYPLTVDGTVFPKSPKELLKEKPFHSVPFLMGVNNHEFSWLIPRGLGLLD
TMEQMSREDMLAISTPVFTSLDVPPEMMPTVIDEYIGSNSDAQAKCQAFQEFMGDVFINV
PTVSFSRYLRDSGSPVFFYEFQHRPSSFVKIKPAWVKADHAAEGAFVFGGPFLMDXSSRL
AFPEATEEEKQLTLTMMAQWTHFAWTGDPNSKGLPPWPQFNQAEQYLEINPVPRAGQKFR
EAWMQFWSETLPSKIQQWHQKXKNRKAQEDL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggagacagccgtgagagtggagtccggggtcctggtcggggtggtctgtctgctcctg
gcatgccctgccacagccactgggcccgaagttgctcagcctgaagtagacaccaccctg
ggtcgtgtgcgaggccggcaggtgggcgtgaagggcacagaccgccttgtgaatgtcttt
ctgggcattccatttgcgcagccgccactggggcctaaccggttctcaggcccacgccca
gcacagccctgggagggtgtgcgggatgccagcactgcgcccccaatgtgcctacaagac
gtggagagcatgaacaacagcagatttgtcctcaatggaaaacagcagatcttctccgtt
tcagaggactgcctggtcctcaacatctatagcccagctgaggcccccgcagggtccggt
aggccggtcatggtatgggtccatggaggcgctctgataactggcactgccacctcctac
aatggatcagccctggctgcctatggggatgtggtggtggttacagtccagtaccgcctt
ggggtccttggcttcttcagcactggagatgagcatgcacctggcaaccagggcttccta
gatgtggtagctgctttgcactgggtgcaaggaaacatcacccccttcgggggtgacctc
aactgtgtcactgtctttggtggatctgccggtgggagcatcatctctggcctgatcctg
tccccagtggctgcagggctgttccacagagccatcacacagagtggggtcatcaccacc
ccagggatcatcgactctcacccttggcccctagctcagaaaatcgcaaacaccttggcc
tgcagctccagctccccggctgagatggtgcagtgccttcggcagaaggagggagaagag
ctggtccttagcaagaagctgaaaactactgtctatcctctcaccgttgatggcactgtc
ttccccaaaagccccaaggaactcctgaaggagaagcccttccactctgtgcccttcctc
atgggtgtcaacaaccatgagttcagctggctcatccccaggggcttgggtctcctggat
acaatggaacagatgagccgggaggacatgctggccatctcaacacccgtcttcaccagt
ctggatgtgccccctgagatgatgcccaccgtcatagatgaatacataggaagcaactcg
gacgcacaagccaaatgccaggcgttccaggaattcatgggtgacgtattcatcaatgtt
cccaccgtcagtttttcaagataccttcgagattctggaagccctgtgtttttctatgag
ttccagcatcgacccagttcttttgtgaagatcaaacccgcctgggtgaaggctgatcat
gcggctgagggtgcttttgtgtttggaggtcccttcctcatggattagagctcccgcctg
gcctttccagaggccacagaggaggagaagcagctaaccctcaccatgatggctcagtgg
acccactttgcctggacaggggaccccaatagcaagggtctgcctccttggccccaattc
aaccaggcggaacaatatctggagatcaacccagtgccacgggccggacagaagttcagg
gaggcctggatgcagttctggtcagagacgctgcccagcaagatacaacagtggcaccag
aaatagaagaacaggaaggcccaggaagacctttga

DBGET integrated database retrieval system