KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101143612Help
Entry
101143612         CDS       T02442                                 

Definition
histone-lysine N-methyltransferase MLL5-like isoform 1
Orthology
K09189  
histone-lysine N-methyltransferase MLL5 [EC:2.1.1.43]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101143612
Enzymes [BR:ggo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101143612
Transcription factors [BR:ggo03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    101143612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 453 aa AA seqDB search
MSIVIPLGVDTAETSYLEMAAGSEPESVEASPVVVEKSNSYPHQLYTSSSHHSHSYIGLP
YADHNYGARPPPTPPASPPPSVLISKNEVGIFTTPNFDETSSATTISTSEDGSYGTDVTR
CICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDKERAVLLQRRK
RENMSDGDTSATESGDEVPVELYTAFQHTPTSITLTASRVSKVNDKRRKKSGEKEQHISK
CKKAFREGSRKSSRVKGSAPEIDPSSDGSNFGWETKIKAWMDRYEEANNNQYSEGVQREA
QRIALRLGNGNDKKEMNKSDLNTNNLLFKPPVESHIQKNKKILKSAKDLPPDALIIEYRG
KFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHE
IQDGTIHLYIYSIHSIPKGTEITIAFDFDYGNW
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagtgatcccattgggggttgatacagcagagacgtcatacttggaaatggct
gcaggttcagaaccagaatccgtagaagctagccctgtggtagttgagaaatccaacagt
tatccccaccagttatataccagcagctcacatcattcacacagttacattggtttgccc
tatgcggaccataattatggtgctcgtcctcctccaacacctccggcttcccctcctcca
tcagtccttattagcaaaaatgaagtaggcatatttaccactcctaattttgatgaaact
tccagtgctactacaatcagcacatctgaggatggaagttatggtactgatgtaaccagg
tgcatatgtggttttacacatgatgatggatacatgatctgttgtgacaaatgcagcgtt
tggcaacatattgactgcatggggattgataggcagcatattcctgatacatatctatgt
gaacgttgtcagcctaggaatttggataaagagagggcagtgctactacaacgccggaaa
agggaaaatatgtcagatggtgataccagtgcaactgagagtggtgatgaggttcctgtg
gaattatatactgcatttcagcatactccaacatcaattactttaactgcttcaagagtt
tccaaagttaatgataaaagaaggaaaaaaagcggggagaaagaacaacacatttcaaaa
tgtaaaaaggcatttcgtgaaggatctaggaagtcatcaagagttaagggttcagctcca
gagattgatccttcatctgatggttcaaattttggatgggagacaaagatcaaagcatgg
atggatcgatatgaagaagcaaataacaaccagtatagtgagggtgttcagagggaggca
caaagaatagctctgagattaggcaatggaaatgacaaaaaagagatgaataaatcagat
ttgaataccaacaatttgctcttcaaacctcctgtagagagccatatacaaaagaataag
aaaattcttaaatctgcaaaagatttgcctcctgatgcacttatcattgaatacagaggg
aagtttatgctgagagaacagtttgaagcaaatgggtatttctttaaaagaccataccct
tttgtgttattctactctaaatttcatgggctagaaatgtgtgttgatgcaaggactttt
gggaatgaggctcgattcatcaggcggtcttgtacacccaatgcagaggtgaggcatgaa
attcaagatggaaccatacatctttatatttattctatacacagtattccaaagggaact
gaaattactattgcctttgattttgactatggaaattggtga

DBGET integrated database retrieval system