KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101143749Help
Entry
101143749         CDS       T02442                                 

Gene name
ACHE
Definition
acetylcholinesterase isoform 1
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ggo00564]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:ggo04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 614 aa AA seqDB search
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPV
SAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM
NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV
GMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG
VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY
EIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ
YVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccccgcagtgtctgctgcacacgccttccctggcttccccactccttctcctc
ctcctctggctcctgggaggaggagtgggggctgagggccgggaggatgcagagctgctg
gtgacggtgcgtgggggccggctgcggggcattcgcctgaagacccccgggggccctgtc
tctgctttcctgggcatcccctttgcggagccacccatgggaccccgtcgctttctgcca
ccggagcccaagcagccttggtcaggggtggtagacgctacaaccttccagagtgtctgc
taccaatatgtggacaccctatacccaggttttgagggcaccgagatgtggaaccccaac
cgtgagctgagcgaggactgcctgtacctcaacgtgtggacaccatacccccggcctaca
tcccccacccctgtcctcgtctggatctatgggggtggcttctacagtggggcctcctcc
ttggacgtgtacgatggccgcttcttggtacaggccgagaggactgtgctggtgtccatg
aactaccgggtgggagcctttggcttcctggccctgccggggagccgagaggccccgggc
aatgtgggtctcctggatcagaggctggccctgcagtgggtgcaggagaacgtggcagcc
tttgggggtgacccgacatcagtgacgctgtttggggagagcgcgggagccgcctcggtg
ggcatgcacctgctgtccccgcccagccggggcctgttccacagggccgtgctgcagagc
ggtgcccccaatggaccctgggccacggtgggcatgggagaggcccgtcgcagggccacg
cagctggcccaccttgtgggctgtcctccaggcggcactggtgggaatgacacagagctg
gtagcctgccttcggacacgaccagcgcaggtcctggtgaaccacgaatggcacgtgctg
cctcaagaaagcgtcttccggttctccttcgtgcctgtggtagatggagacttcctcagt
gacaccccagaggccctcatcaacgcgggagacttccacggcctgcaggtgctggtgggt
gtggtgaaggatgagggctcgtattttctggtttacggggccccaggcttcagcaaagac
aacgagtctctcatcagccgggccgagttcctggccggggtgcgggtcggggtcccccag
gtaagtgacctggcagccgaggctgtggtcctgcattacacagactggctgcatcccgag
gacccggcacgcctgagggaggccctgagcgatgtggtgggcgaccacaatgtcgtgtgc
cccgtggcccagctggctgggcgactagctgcccagggtgcccgggtctacgcctacgtc
tttgaacaccgtgcttccacgctctcctggcccctgtggatgggggtgccccacggctac
gagatcgagttcatctttgggatccccctggacccctctcgaaactacacggcagaggag
aaaatcttcgcccagcgactgatgcgatactgggccaactttgcccgcacaggggatccc
aatgagccccgagaccccaaggccccacaatggcccccgtacacggcgggggctcagcag
tacgtgagtctggacctgcggccgctggaggtgcggcgggggctgcgcgcccaggcctgc
gccttctggaaccgcttcctccccaaattgctcagcgccaccgacaccctcgacgaggcg
gagcggcagtggaaggccgagttccaccgctggagctcctacatggtgcactggaagaac
cagttcgaccactacagcaagcaggatcgctgctcagacctgtga

DBGET integrated database retrieval system