KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101144239Help
Entry
101144239         CDS       T02442                                 

Gene name
ACR
Definition
LOW QUALITY PROTEIN: acrosin
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     101144239 (ACR)
Peptidases [BR:ggo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101144239 (ACR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 428 aa AA seqDB search
MVEMLPTAILLVLAVSAVAKDNATCDGPCGLRFRQNPQGGVRIVGGKAAQHGAWPWMVSL
QIFTYNSHRYHTCGGSLLNSRWVLTAAHCFVGKNNVHGWRLVFGAKEITYGNNKPVKAPL
QERYVEKIIIHEKYNSATEGNDIALVKITPPISCGRFIGPGCLPHFKAGLPRGSQSCWVA
GWGYIEEKAPRPSSMLMEARVDLIDLDLCNSTQWYNGRVQPTNVCAGYPVGKIDTCQGDS
GGPLMCKDSKESAYVVVGITSWGVGCARAKRPGIYTATWPYLNWIASKIGSNALHMIQSA
TPPPPTTRPPPIRPPFSHPISVHLPWYFQPPPRPLPPRPPAAQPRPPPSPPPPPPPPPSP
LLPPPPTXXXXPPPPPPTPSSTTKLPQGLSFAKRLQQLIEVLKGKTYSDGKDHYDMETTE
LPELTSTS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggttgagatgctaccaactgccattctgctggtcttggcagtgtccgcggttgctaaa
gataacgccacgtgtgatggcccctgcgggttacggttcaggcaaaacccacagggtggt
gtccgcatcgtcggcgggaaggctgcacagcatggggcctggccctggatggtcagcctc
cagatcttcacgtacaatagccacaggtaccacacatgtggaggcagcttgctgaattca
cgatgggtgctcactgctgctcactgcttcgtcggcaaaaataatgtgcatggctggaga
ctggttttcggagcaaaggaaattacatatgggaacaataaaccagtaaaggcgcctctg
caagagagatatgtggagaaaatcatcattcatgaaaaatacaactctgcaacagaggga
aatgacatcgccctcgtgaagatcacccctcccatttcgtgtgggcgcttcattggtccg
ggctgcctgccccactttaaggcaggcctccccagaggctcccagagctgctgggtggct
ggctggggatatatagaagagaaagcccccaggccatcatctatgctgatggaggcacgt
gtggatctcatcgacctggacttgtgtaactccacccagtggtacaacgggcgcgttcag
ccaaccaatgtgtgcgcggggtatcctgtaggcaagatcgacacctgccagggggacagc
ggcgggcctctcatgtgcaaagacagcaaggaaagcgcctatgtggtcgtgggaatcaca
agctggggggtaggctgtgcccgtgccaagcgccccggaatctacacggccacctggccc
tatctgaactggatcgcctccaagatcggttctaacgctctgcatatgattcaatcggcc
acccctccacctcccaccactcgaccgcccccgattcgaccccccttctcccaccctatc
tctgttcaccttccttggtatttccaaccaccccctcgaccacttccaccccgaccacct
gcagcccagccccgacccccaccttcacccccgcccccacccccacctccaccctcacct
ttactcccacccccacccaccnnnnnnnnnnccccacccccacccccacctacaccctca
tctaccacaaaacttccccaaggactttcttttgccaagcgcctacagcagctcatagag
gtcttgaaggggaagacctattccgacggaaaggaccattatgacatggagaccacagag
ctcccagaactgacctcgacctcctga

DBGET integrated database retrieval system