KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101145053Help
Entry
101145053         CDS       T02442                                 

Gene name
SCD5
Definition
(RefSeq) stearoyl-CoA desaturase 5
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01040  Biosynthesis of unsaturated fatty acids
ggo01212  Fatty acid metabolism
ggo03320  PPAR signaling pathway
ggo04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    101145053 (SCD5)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    101145053 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101145053 (SCD5)
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     101145053 (SCD5)
Lipid biosynthesis proteins [BR:ggo01004]
 Desaturase
  First
   101145053 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 101145053
NCBI-ProteinID: XP_004038944
UniProt: A0A2I2ZW12
Position
4
AA seq 256 aa AA seqDB search
MPGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVLMSLLHLGA
VYSLVLIPKAKPLTLLWAYFCFLLAALGVTAGAHRLWSHRSYRAKLPLRIFLAVANSMAF
QNDIFEWSRDHRAHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLL
ADPVVRIQRNTQHIQKQGRALNQEAACEMLREWHQGHILKVTLPGLYILALLHTHCNHSE
KCCLMLRALSVSLEVF
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcccggccaccgacgcggggaagatccctttctgcgacgccaaggaagaaatc
cgtgccgggctcgaaagctctgagggcggcggcggcccggagaggccaggcgcgcgcggg
cagcggcagaacatcgtctggaggaatgtcgtcctgatgagcttgctccacttgggggcc
gtgtactccctggtgctcatccccaaagccaagccactcactctgctctgggcctacttc
tgcttcctcctggccgctctgggtgtgacagctggtgcccatcgcttgtggagccacagg
tcctacagggccaagctgcctctgaggatatttctggctgtggccaactccatggctttc
cagaatgacatcttcgagtggtccagggaccaccgagcccaccacaagtactcagagacg
gatgctgacccacacaatgcccgccggggcttcttcttctcccatatcgggtggctgttt
gttcgcaagcatcgagatgttattgagaaggggagaaagcttgacgtcactgacctgctt
gctgatcctgtggtccggatccagagaaatacacagcacatccagaaacaaggaagagct
ctcaatcaagaggcagcgtgtgagatgcttcgtgaatggcatcaagggcatatactgaaa
gtcacccttcccggattatacattttagctttgttacatactcattgtaaccactccgaa
aagtgctgcttgatgctgcgtgccctttctgtgtccctggaggtattctga

DBGET integrated database retrieval system