KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101145247Help
Entry
101145247         CDS       T02442                                 

Gene name
KAT6B
Definition
histone acetyltransferase KAT6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 2072 aa AA seqDB search
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSAKGSRGSCNDLRNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLD
GKGAPQYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRVQGRNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLA
TGTTQKLKPPPSSLPPPTPISGQSPSSQKSSTATSSPSPQSSSSQCSVPSLSSLTTNSQL
KALFDGLSHIYTTQGQSRKKGHPSYAPPKRMRRKTELSSTAKSKAHFFGKRDIRSRFISH
SSSSSWGMARGSIFKAIAHFKRTTFLKKHRMLGRLKYKVTPQMGTPSPGKGSLTDGRIKP
DQDDDTEIKINIKQESADVNVIGNKDVVTEEDLDVFKQAQELSWEKIECESGVEDCGRYP
SVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANE
IYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLV
GYFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRL
SYLAYWKSVILEYLYHHHERHISIKAISRATGMCPHDIATTLQHLHMIDKRDGRFVIIRR
EKLILSHMEKLKTCSRANELDPDSLRWTPILISNAAVSEEEREAEKEAERLMEQASCWEK
EEQEILSTRANSRQSPAKVQSKNKYLHSPESRPVTGERGQLLELSKESSEEEEEEEDEEE
EEEEEEEEDEEEEEEEEEEEEENIQSSPPRLTKPQSVAIKRKRPFVLKKKRGRKRRRINS
SVTTETISETTEVLNEPFDNSDEERPMPQLEPTCEIEVEEDGRKPVLRKAFQHQPGKKRQ
TEEEEGKDNHCFKNADPCRNNMNDDSSNLKEGSKDNPEPLKCKQVWPKGTKRSLSKWRQN
KERKTGFKLNLYTPPETPMEPDEQVTVEEQKETSEGKTSPSPIRIEEEVKETGEALLPQE
ENKREETCAPVSPNTSPGEKPEDELIKPEEEEEEEEEEEEEEEEEEGEEEEEGGGNVEKD
PDGAKSQEKEEPEISTEKEDSARLDDHEEEEEEDEEPSHNEDHDADDEDDSHMDSAEVEK
EELPRESFKEVLENQEAFLDLNVQPGHSNPEVLMDCGVDLTASCNSEPKELAGDPEAVPE
SDEEPPPGEQAQKQDQKNSKEVDTEFKEGNPATMEIDSETVQAVQSLTQESSEQDDTFQD
CAETQEACRSLQNYTRADQSPQIAATLDDCQQSDHSSPVSSVHSHPGQSVRSVNSPSVPA
LENSYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYE
NPSSYDSTMGGSICGNGSSQNSCSYSNLTSSSLTQSSCAVTQQMSNISGSCSMLQQTSIS
SPPTCSVKSPQGCVVERPPSSSQQLAQCSMAANFTPPMQLAEIPETSNANIGLYERMGQS
DFGAGHYPQPSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQL
SQSPHSVPGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMAASNIGISHSQRLQTQIASKG
HVSMRTKSASLSPAAATHQSQIYGRSQTVAMQGPARTLTMQRGMNMSVNLMPAPAYNVNS
VNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMGTQPYAQQPMQTP
PHGNMMYTAPGHHGYMNTGMSKQSLNGSYMRR
NT seq 6219 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttatacagagtggattcttgaagctatacagaaaata
aaaaagcaaaagcaaaggccctctgaagagagaatctgccatgcggtcagtacttcccat
gggttggataagaagacagtctctgaacagctggaactcagtgttcaggatggctcagtt
ctcaaagtcaccaacaaaggccttgcctcctataaggacccagacaaccctgggcgcttt
tcatcagttaaaccaggcacttttcctaagtcagccaaggggtctagaggatcatgtaat
gatctccgcaatgtggattggaataaacttttaaggagagcaattgaaggacttgaggag
ccgaatggctcctccctgaagaacatagagaagtatctcagaagtcaaagtgatctcaca
agcaccaccaacaacccagcctttcagcagcggctgcgactgggggccaaacgcgctgtg
aataatgggaggttactgaaagacggaccgcagtacagggtcaattatgggagcttagat
ggcaaaggggcacctcagtatcccagtgcattcccatcctcgctcccacctgtcagcctt
ctaccccatgagaaagaccagccccgtgctgatcccattccaatatgtagcttctgtttg
gggactaaagaatcaaatcgtgaaaagaaaccagaagaactcctctcttgtgcagattgt
ggcagtagtggacacccatcctgtttgaaattttgtcctgaattaacaacaaatgtaaag
gccttaaggtggcagtgcatcgaatgcaagacatgcagtgcctgtagagtccaaggcaga
aatgctgataatatgcttttttgtgattcctgtgatagaggatttcatatggaatgctgt
gacccaccactttccagaatgccaaaagggatgtggatttgccaagtctgcagaccaaag
aaaaagggaagaaaactacttcatgagaaagctgcacaaataaaacgacgatatgcaaaa
cccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagtgatgaa
ggatccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgggaaggactcaagcagcagattggct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacatt
tctgcctctacacttaaagttaacaagaaaaccaaagggctcattgatggccttactaag
ttttttacaccatcacctgatggtcgcagatcacgaggtgaaattatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcatgtgttggct
acaggtaccacacaaaagctaaaacctccaccttcttcacttccacccccaacccccatc
tccggtcagagccccagttcacaaaagtccagcacggccacttcttctccctctccccag
agttcttccagccagtgcagtgtgccctccctgagcagccttaccactaacagccagctg
aaggcactctttgatgggctttctcatatctataccactcagggacagtctcgcaaaaag
ggacacccgagttatgcaccacccaaacgtatgcgtcgtaaaactgaattatcttccacg
gcaaaatctaaagcccacttctttggcaaaagagatattagaagtcggtttatttctcac
tcctcctcctctagctgggggatggctagaggaagtatttttaaagcaattgctcacttc
aagcgaacaactttccttaaaaagcacaggatgctaggcagattaaaatataaagtgacc
cctcagatggggaccccctcaccagggaaggggagcttgacagacggaaggattaaacct
gatcaggatgatgatactgaaataaaaataaacatcaaacaagaaagtgcagatgtaaat
gtgattggaaacaaggatgtcgttactgaagaggatttggatgtttttaagcaggcccag
gaactttcttgggagaaaatagagtgtgagagtggggtggaagactgtggccggtaccct
tctgtgattgaatttggtaaatatgaaatccaaacctggtactcctcgccttacccacag
gaatatgcaagattaccaaagctttacctgtgtgaattctgtcttaaatatatgaaaagt
aaaaatattttgctaagacactccaagaagtgtggatggtttcatcctccagcaaatgaa
atttaccgaaggaaagacctttcagtatttgaggttgatgggaatatgagcaaaatttat
tgccaaaacctttgcttgttagccaagctcttcctggaccacaaaacgttgtattatgat
gtcgagccattccttttttatgtccttacaaaaaatgatgaaaagggctgtcatctggtt
ggatacttctctaaggaaaagctttgccagcagaagtataatgtctcctgcataatgatc
atgccccagcaccaaaggcaaggatttggacggtttctcattgatttcagctatttgctt
tctagaagagaaggccaagcagggtctcctgaaaagcctctctccgatctgggccgtctc
tcctacctggcatattggaagagcgtcatcttggagtatctctaccaccaccatgagagg
cacatcagcatcaaggcaattagcagagcgacgggcatgtgcccacatgacattgccacc
actctgcagcacctccacatgatcgacaagagagatggcagatttgtcatcattagacgg
gaaaagttgatattgagccacatggaaaagctgaaaacctgttccagagccaatgaactt
gatccagacagtctgaggtggaccccaattttaatttctaatgctgcagtgtctgaagaa
gagcgagaagctgagaaagaggctgagcggctaatggaacaagctagctgctgggagaag
gaggaacaagaaatcctgtcaactagagctaacagtaggcaatcacctgcaaaagtacaa
tcgaaaaataaatatttgcattccccggagagccggccagtcacaggggagcgagggcag
ctgctggagctgtctaaagagagcagtgaagaagaagaggaggaggaggacgaggaggag
gaagaagaggaggaggaggaagaggacgaagaggaggaagaagaggaagaagaagaagaa
gaagaaaatattcaaagctctcccccaagattgacgaaaccacagtcagttgccataaag
agaaagaggccttttgtactaaagaagaaaaggggtcgtaaacgcaggaggatcaacagc
agtgtaacaacagagaccatttcagagacgacagaagtactgaatgagccctttgacaac
tcagatgaagagaggccaatgccacagctggagcctacctgtgagattgaagtggaggaa
gatggcaggaagccagtcctgagaaaagcattccaacatcagcctgggaagaaaagacaa
acagaggaagaggaaggaaaagacaatcattgcttcaagaatgctgacccttgtagaaac
aatatgaatgatgattcaagtaacttgaaagaaggcagtaaagacaatcccgaacctcta
aagtgcaaacaagtgtggccaaaaggaacaaagcgcagtctatctaagtggaggcaaaac
aaagagaggaagactggatttaaactgaatttgtacaccccgccagaaacacccatggag
cctgacgagcaggtaacagtggaagaacagaaggagacttcagaaggaaaaaccagcccc
agtcccatcaggattgaggaggaggtcaaggaaactggggaagccctgctgcctcaagag
gaaaacaaaagggaagaaacatgtgcccctgtaagtccaaacacatcaccaggtgaaaaa
ccagaagatgaactcatcaaacctgaggaagaggaagaggaggaggaggaggaagaggaa
gaagaggaagaagaggaaggggaagaagaagaagaaggaggaggaaatgtagaaaaagat
ccagatggtgctaaaagccaagaaaaagaggaaccagaaatctccacggaaaaagaagac
tctgcacgtttggatgatcacgaagaggaggaggaagaggatgaagagccatcccacaac
gaggaccatgatgccgatgacgaggatgacagccacatggactctgccgaagtggagaag
gaagagctgcccagagaaagcttcaaagaagtactggaaaaccaggaggcttttttagac
cttaatgtgcagcctggtcactcgaacccagaggtcttaatggactgtggtgtcgacctg
acagcttcttgtaacagtgagcccaaggagcttgctggggaccctgaagctgtacccgaa
tctgacgaggagccacccccaggagaacaggcacagaagcaggaccaaaagaacagcaaa
gaagtcgatacagagttcaaagagggaaacccagcaaccatggaaatcgactctgagact
gtccaggcagttcagtctttgacccaggagagcagtgaacaggacgacacctttcaggat
tgtgccgagactcaagaggcctgtagaagcctacagaattacacccgtgcagaccaaagt
ccacagattgctgccacgctcgatgattgccaacagtcggaccacagtagcccagtttca
tccgtccactcccatcctggccagtccgtacgttctgtcaacagcccaagtgtccctgct
ctggaaaacagctatgcccaaatcagcccagatcaaagtgccatctcagtgccatctctg
cagaacatggaaaccagtcccatgatggatgtaccatcagtttcagatcattcacagcaa
gtcgtagacagtggatttagtgacctgggcagtatcgagagcacaactgagaactacgaa
aacccaagcagctacgattctactatgggaggcagcatctgtggaaacggctcttcacag
aacagctgctcctatagcaacctcacctccagcagtctgacacagagcagctgtgctgtc
acccagcagatgtccaacatcagcgggagctgcagcatgctgcagcaaaccagcatcagc
tcccctccgacctgcagcgtcaagtctcctcaaggctgtgtggtggagaggcctccgagc
agcagccagcagctggctcagtgcagcatggctgctaacttcaccccacccatgcagctg
gctgaaatccccgagacgagcaacgccaacattggcttatacgagcgaatgggtcagagt
gattttggggctgggcattacccacagccgtcagccaccttcagccttgccaaacttcag
cagttaactaatacacttattgatcattcattgccttacagccattccgctgctgtgact
tcctatgcaaacagtgcctctttgtccacaccattaagtaacacagggcttgttcagctt
tctcagtctccacactccgtccctgggggaccccaagcacaagctaccatgaccccaccc
cccaacctgactcctcctccaatgaatctgccgccgcctcttttgcaacggaacatggct
gcatcaaatattggcatctctcacagccaaagactgcaaacccagattgccagcaagggc
cacgtctccatgagaaccaagtcagcgtctctgtcaccagccgctgccacccatcagtca
caaatctatgggcgctcccagactgtagccatgcagggtcctgcacggactttaacgatg
caaagaggcatgaacatgagtgtgaacctgatgccagcgccagcctacaatgtcaactct
gtgaacatgaacatgaacactctcaacgccatgaatgggtacagcatgtcccagccaatg
atgaacagtggctaccacagcaatcatggctatatgaatcaaacgccccaataccctatg
cagatgcagatgggcatgatgggcacccagccatatgcccagcagccaatgcagacccca
ccccacggtaacatgatgtacacggcccccggacatcacggctacatgaacacaggcatg
tccaaacagtctctcaatggctcctacatgagaaggtag

DBGET integrated database retrieval system