KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101145521Help
Entry
101145521         CDS       T02442                                 

Gene name
RNASE1
Definition
ribonuclease pancreatic isoform 1
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 156 aa AA seqDB search
MALEKSLVLLPLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSNSTYCNQMMRR
RNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRY
PNCAYRTSPKERHIIVACEGNPYVPVHFDASVEDST
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggctctggagaagtctcttgtcctgctccctctgcttgtcctgatactgctggtgctg
ggctgggtccagccttccctgggcaaggaatcccgggccaagaaattccagcggcagcat
atggactcagacagttcccccagcagcaactccacctactgtaaccaaatgatgaggcgc
cggaatatgacacaggggcgatgcaaaccagtgaacacctttgtgcacgagcccctggta
gatgtccagaatgtctgtttccaggaaaaggtcacctgcaagaacgggcagggcaactgc
tacaagagcaactccagcatgcacatcacagactgccgcctgacaaacggctccaggtac
cccaactgtgcataccggaccagcccgaaggagagacacatcattgtggcctgtgaaggg
aacccatatgtgccagtccacttcgatgcttctgtggaggactccacctaa

DBGET integrated database retrieval system