KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101145647Help
Entry
101145647         CDS       T02442                                 

Gene name
KAT2B
Definition
(RefSeq) lysine acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101145647 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101145647 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101145647 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    101145647 (KAT2B)
Enzymes [BR:ggo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101145647 (KAT2B)
Transcription machinery [BR:ggo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101145647 (KAT2B)
Chromosome [BR:ggo03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101145647 (KAT2B)
   HAT complexes
    PCAF complex
     101145647 (KAT2B)
    STAGA complex
     101145647 (KAT2B)
    TFTC complex
     101145647 (KAT2B)
    SAGA complex
     101145647 (KAT2B)
    SLIK complex
     101145647 (KAT2B)
    ADA-HAT complex
     101145647 (KAT2B)
    HAT-A2 complex
     101145647 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
ENSGGOG00000016696
UniProt: 
Position
3
AA seq 799 aa AA seqDB search
PAPPQGSPCAAAAGGSGACGPATAVAAAGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEK
LGVYSACKAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTESCRSCSHALAAHVSHLENV
SEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKK
PPFEKPSIEQGVNNFVQYKFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPND
DISGYKENYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDK
LPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGT
ISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKKPRVMGDIPMEL
INEVMSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKILM
WLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVF
CAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKY
VGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKD
GVRQIPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVK
RTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCA
NILEKFFFSKIKEAGLIDK
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
cccgcgcccccgcagggctccccctgcgctgctgccgccgggggctcgggcgcctgcggt
ccggcgacggcagtggctgcagcgggcacggccgaaggaccgggaggcggtggctcggcc
cgaatcgccgtgaagaaagcgcaactacgctccgctccgcgggccaagaaactggagaaa
ctcggagtgtactccgcctgcaaggccgaggagtcttgtaaatgtaatggctggaaaaac
cctaacccctcacccactccccccagagccgatctgcagcaaataattgtcagtctaaca
gaatcctgtcggagttgtagccatgccctagctgctcatgtttcccacctggagaatgtg
tcagaggaagaaatgaacagactcctgggaatagtattggatgtggaatatctctttacc
tgtgtccacaaggaagaagatgcagataccaaacaagtttatttctatctatttaagctc
ttgaggaagtctattttacaaagaggaaaacctgtggttgaaggctctttggaaaagaaa
cccccatttgaaaaacctagcattgaacagggtgtgaataactttgtacagtacaaattt
agtcacctgccagcaaaagaaaggcaaacaatagttgagttggcaaaaatgttcctaaac
cgcatcaactattggcatctggaggcaccatctcaacgaagactgcgatctcccaatgat
gatatttctggatacaaagagaactacacaaggtggctgtgttactgcaacgtgccacag
ttctgcgacagtctacctcggtacgaaaccacacaggtgtttgggagaacattgcttcgc
tcggtcttcactgttatgaggcgacaactcctggaacaagcaagacaggaaaaagataaa
ctgcctcttgaaaaacgaactctaatcctcactcatttcccaaaatttctgtccatgcta
gaagaagaagtttatagtcaaaactctcccatctgggatcaggattttctctcagcctct
tccagaaccagccagctaggcatccaaacagttatcaatccacctcctgtggctgggaca
atttcatacaattcaacctcatcttcccttgagcagccaaacgcagggagcagcagtcct
gcctgcaaagcctcttctggacttgaggcaaacccaggagaaaagaggaaaatgactgat
tctcatgttctggaggaggccaagaaaccccgagttatgggggatattccgatggaatta
atcaacgaggttatgtctaccatcacggaccctgcagcaatgcttggaccagagaccaat
tttctgtcagcacactcggccagggatgaggcggcaaggttggaagagcgcaggggtgta
attgaatttcacgtggttggcaattccctcaaccagaaaccaaacaagaagatcctgatg
tggctggttggcctacagaacgttttctcccaccagctgccccgaatgccaaaagaatac
atcacacggctcgtctttgacccgaaacacaaaacccttgctttaattaaagatggccgt
gttattggtggtatctgtttccgtatgttcccatctcaaggattcacagagattgtcttc
tgtgctgtaacctcaaacgagcaagtcaagggctatggaacacacctgatgaatcatttg
aaagaatatcacataaagcatgacatcctgaacttcctcacatatgcagatgaatatgca
attggatactttaagaaacagggtttctccaaagaaattaaaatacctaaaaccaaatat
gttggctatatcaaggattatgaaggagccactttaatgggatgtgagctaaatccacgg
atcccgtacacagaattttctgtcatcattaaaaagcagaaggagataattaaaaagctg
attgaaagaaaacaggcacaaattcgaaaagtttaccctggactttcatgttttaaagat
ggagttcgacagattcctatagaaagcattcctggaattagagagacaggctggaaaccg
agtggaaaagagaaaagtaaagagcccagagaccctgaccagctttacagcacgctcaag
agcatcctccagcaggtgaagagccatcaaagcgcttggcccttcatggaacctgtgaag
agaacagaagctccaggatattatgaagttataaggttccccatggatctgaaaaccatg
agtgaacgcctcaagaataggtactacgtgtctaagaaattattcatggcagacttacag
cgagtctttaccaattgcaaagagtacaacccccctgagagtgaatactacaaatgtgcc
aatatcctggagaaattcttcttcagtaaaattaaggaagctggattaattgacaagtga

DBGET integrated database retrieval system