KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101145647Help
Entry
101145647         CDS       T02442                                 

Gene name
KAT2B
Definition
histone acetyltransferase KAT2B
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101145647 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101145647 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101145647 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    101145647 (KAT2B)
Enzymes [BR:ggo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101145647 (KAT2B)
Transcription machinery [BR:ggo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101145647 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 818 aa AA seqDB search
MAKICETSQQSQERVTLXXPAPPQGSPCAAAAGGSGACGPATAVAAAGTAEGPGGGGSAR
IAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTE
SCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLL
RKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKERQTIVELAKMFLNR
INYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRS
VFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASS
RTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKMTDS
HVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVI
EFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRV
IGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAI
GYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLI
ERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKS
ILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQR
VFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatctgcgaaacatctcagcagagccaggagagagtaacactgnnnncgccc
gcgcccccgcagggctccccctgcgctgctgccgccgggggctcgggcgcctgcggtccg
gcgacggcagtggctgcagcgggcacggccgaaggaccgggaggcggtggctcggcccga
atcgccgtgaagaaagcgcaactacgctccgctccgcgggccaagaaactggagaaactc
ggagtgtactccgcctgcaaggccgaggagtcttgtaaatgtaatggctggaaaaaccct
aacccctcacccactccccccagagccgatctgcagcaaataattgtcagtctaacagaa
tcctgtcggagttgtagccatgccctagctgctcatgtttcccacctggagaatgtgtca
gaggaagaaatgaacagactcctgggaatagtattggatgtggaatatctctttacctgt
gtccacaaggaagaagatgcagataccaaacaagtttatttctatctatttaagctcttg
aggaagtctattttacaaagaggaaaacctgtggttgaaggctctttggaaaagaaaccc
ccatttgaaaaacctagcattgaacagggtgtgaataactttgtacagtacaaatttagt
cacctgccagcaaaagaaaggcaaacaatagttgagttggcaaaaatgttcctaaaccgc
atcaactattggcatctggaggcaccatctcaacgaagactgcgatctcccaatgatgat
atttctggatacaaagagaactacacaaggtggctgtgttactgcaacgtgccacagttc
tgcgacagtctacctcggtacgaaaccacacaggtgtttgggagaacattgcttcgctcg
gtcttcactgttatgaggcgacaactcctggaacaagcaagacaggaaaaagataaactg
cctcttgaaaaacgaactctaatcctcactcatttcccaaaatttctgtccatgctagaa
gaagaagtttatagtcaaaactctcccatctgggatcaggattttctctcagcctcttcc
agaaccagccagctaggcatccaaacagttatcaatccacctcctgtggctgggacaatt
tcatacaattcaacctcatcttcccttgagcagccaaacgcagggagcagcagtcctgcc
tgcaaagcctcttctggacttgaggcaaacccaggagaaaagaggaaaatgactgattct
catgttctggaggaggccaagaaaccccgagttatgggggatattccgatggaattaatc
aacgaggttatgtctaccatcacggaccctgcagcaatgcttggaccagagaccaatttt
ctgtcagcacactcggccagggatgaggcggcaaggttggaagagcgcaggggtgtaatt
gaatttcacgtggttggcaattccctcaaccagaaaccaaacaagaagatcctgatgtgg
ctggttggcctacagaacgttttctcccaccagctgccccgaatgccaaaagaatacatc
acacggctcgtctttgacccgaaacacaaaacccttgctttaattaaagatggccgtgtt
attggtggtatctgtttccgtatgttcccatctcaaggattcacagagattgtcttctgt
gctgtaacctcaaacgagcaagtcaagggctatggaacacacctgatgaatcatttgaaa
gaatatcacataaagcatgacatcctgaacttcctcacatatgcagatgaatatgcaatt
ggatactttaagaaacagggtttctccaaagaaattaaaatacctaaaaccaaatatgtt
ggctatatcaaggattatgaaggagccactttaatgggatgtgagctaaatccacggatc
ccgtacacagaattttctgtcatcattaaaaagcagaaggagataattaaaaagctgatt
gaaagaaaacaggcacaaattcgaaaagtttaccctggactttcatgttttaaagatgga
gttcgacagattcctatagaaagcattcctggaattagagagacaggctggaaaccgagt
ggaaaagagaaaagtaaagagcccagagaccctgaccagctttacagcacgctcaagagc
atcctccagcaggtgaagagccatcaaagcgcttggcccttcatggaacctgtgaagaga
acagaagctccaggatattatgaagttataaggttccccatggatctgaaaaccatgagt
gaacgcctcaagaataggtactacgtgtctaagaaattattcatggcagacttacagcga
gtctttaccaattgcaaagagtacaacccccctgagagtgaatactacaaatgtgccaat
atcctggagaaattcttcttcagtaaaattaaggaagctggattaattgacaagtga

DBGET integrated database retrieval system