KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101145906Help
Entry
101145906         CDS       T02442                                 

Definition
UDP-glucuronosyltransferase 2A1-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101145906
   00053 Ascorbate and aldarate metabolism
    101145906
   00500 Starch and sucrose metabolism
    101145906
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101145906
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101145906
   00860 Porphyrin and chlorophyll metabolism
    101145906
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101145906
   00982 Drug metabolism - cytochrome P450
    101145906
   00983 Drug metabolism - other enzymes
    101145906
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    101145906
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101145906
Glycosyltransferases [BR:ggo01003]
 Others
  Hydrophobic molecule
   101145906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 448 aa AA seqDB search
MLNNLLLFSLQISLIGTTLGGNVLIWPMEGSHWLNVKIIIDELIKKEHNVTVLVASGALF
ITPTSNSSLTFEIYKVPFGKERIEGVIKDFILTWLENRPSPSTIWRFYQEMAKVIKDFHM
VSQEICDGVLKNQQLMEKLKKSKFEVLVSDPVFPCGDIVALKLGIPFMYSLRFSPASTVE
KHCGKVPYPPSYVPAVLSELTDQMSFTDRIRNFISYHLQDYMFETLWKSWDSYYSKALDG
SHWLNIKIILEELIQRNHNVTVLASSATLFINSNPDSPVNFEVIPVSYKKSNIDSLIEHM
IMLWIDHRPTPLTIWAFYKELGKLLDTFFQINIQLCDGVLKNPKLMARLQKGGFDVLVAD
PVTICGDLVALKLGIPFMYTLRFSPASTVERHCGKIPAPVSYVPAALSELTDQMTFGERI
KNTISYSLQDYIFQSYWGEWNSYYSKIL
NT seq 1345 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacaaccttctgctgttctcccttcagataagtctcataggaaccactcttggt
gggaatgttttgatttggccaatggaaggtagtcattggctaaatgttaagataattata
gatgagctcattaaaaaggagcacaatgtgactgtcctagttgcctctggtgcacttttc
atcacaccaacctctaactcatctctgacatttgaaatatataaggtgccctttggcaaa
gaaagaatagaaggagtaattaaggacttcattttgacatggctggaaaatagaccatct
ccttcaaccatttggagattctatcaggagatggccaaagtaatcaaggacttccacatg
gtgtctcaggagatctgtgatggcgttcttaaaaaccaacagctgatggaaaaactaaag
aaaagcaagtttgaagtcctggtgtccgatccagtatttccttgtggcgatatagtagct
ttaaaacttggaattccatttatgtactccttgaggttttctccagcctcaacagtggaa
aagcactgtgggaaggtaccataccctccttcctatgttcctgctgttttatcagaactc
accgaccaaatgtctttcactgacagaataagaaatttcatctcctaccacctacaggac
tacatgtttgaaactctttggaaatcatgggattcatactatagtaaagctttagatggt
agccattggttaaatattaagattattctagaagagttgattcaaagaaatcacaatgtg
actgtactggcttcatcagcaactctattcatcaactccaatcccgattctcctgtgaat
tttgaagtgatacctgtttcctacaagaagagcaatatagattccttaattgagcatatg
ataatgctgtggattgaccatagaccaactcctctcacaatatgggctttctacaaagaa
ctaggaaaacttctagacactttctttcaaattaacatacaactctgtgatggtgtacta
aagaacccaaagttgatggcaagacttcagaaaggtggttttgatgtgttggtagcagac
ccagtaacaatctgtggtgatctcgttgctctgaaattaggaattccatttatgtacaca
ttgaggttctctccagcatcaacagtggagagacactgtgggaaaatcccggcaccagtc
tcctatgtaccggcagccttgtcagagctcactgaccagatgacctttggtgaaaggatt
aaaaataccatatcttattctctgcaagactatatatttcagtcctactggggagaatgg
aattcatactatagcaaaattttag

DBGET integrated database retrieval system