KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101145951Help
Entry
101145951         CDS       T02442                                 

Gene name
C1GALT1
Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101145951 (C1GALT1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     101145951 (C1GALT1)
Glycosyltransferases [BR:ggo01003]
 Glycan extension
  Type 3 chain
   101145951 (C1GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 371 aa AA seqDB search
MSEIHFREMASKSWLNFLTFLCGSAIGFLLCSQLFSILLGEKGDTQPNVLHNDPHARHSD
DNGQNHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWA
QRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDT
YVILDNLRWLLSKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKC
THSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYY
PPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANK
NEDTKVKLGNP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaatacactttcgggaaatggcctctaaatcctggctgaattttttaaccttc
ctctgtggatcagcaataggatttcttttatgttctcagctatttagtattttgttggga
gaaaagggtgacacccagcctaatgttcttcataatgatcctcatgcaaggcattcagat
gataatggacagaatcatctagaaggacaaatgaacttcaatgcagattctagccaacat
aaagatgagaacacagacattgctgaaaacctctatcagaaagttagaattctttgctgg
gttatgaccggccctcaaaacctagagaaaaaggccaaacacgtcaaagctacttgggcc
cagcgttgtaacaaagtgttgtttatgagttcagaagaaaataaagacttccctgctgtg
ggattgaaaaccaaagaaggcagagatcaactatactggaaaacaattaaagcttttcag
tatgttcatgaacattatttagaagatgctgattggtttttgaaagcagatgatgacaca
tatgtcatactagacaatttgaggtggcttctttcaaaatacgaccctgaagaacccatt
tactttgggagaagatttaagccttatgtaaagcagggctacatgagtggaggagcagga
tatgtactaagcaaagaagccttgaaaagatttgttgatgcatttaaaacagacaagtgt
acacatagttcctccattgaagacttagcactggggagatgcatggaaattatgaatgta
gaagcaggagattccagagataccattggaaaagaaacttttcatccctttgtgccagaa
caccatttaattaaaggttatctacctagaacgttttggtactggaattacaactattat
cctcctgtagagggtcctggttgctgttctgatcttgcagtttcttttcactatgttgat
tctacaaccatgtatgagttagaatacctcgtttatcatcttcgtccatatggttattta
tacagatatcaacctaccttacctgaacgtatactaaaggaaattagtcaagcaaacaaa
aatgaagatacaaaagtgaagttaggaaatccttga

DBGET integrated database retrieval system