KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101146131Help
Entry
101146131         CDS       T02442                                 

Gene name
TGFBR2
Definition
TGF-beta receptor type-2 isoform 1
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
Adherens junction
Chagas disease (American trypanosomiasis)
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101146131 (TGFBR2)
   04350 TGF-beta signaling pathway
    101146131 (TGFBR2)
   04390 Hippo signaling pathway
    101146131 (TGFBR2)
   04068 FoxO signaling pathway
    101146131 (TGFBR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101146131 (TGFBR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    101146131 (TGFBR2)
  Cell communication
   04520 Adherens junction
    101146131 (TGFBR2)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    101146131 (TGFBR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101146131 (TGFBR2)
   05202 Transcriptional misregulation in cancers
    101146131 (TGFBR2)
   05210 Colorectal cancer
    101146131 (TGFBR2)
   05212 Pancreatic cancer
    101146131 (TGFBR2)
   05220 Chronic myeloid leukemia
    101146131 (TGFBR2)
  Infectious diseases
   05166 HTLV-I infection
    101146131 (TGFBR2)
   05142 Chagas disease (American trypanosomiasis)
    101146131 (TGFBR2)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101146131 (TGFBR2)
Protein kinases [BR:ggo01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   101146131 (TGFBR2)
Enzyme-linked receptors [BR:ggo01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   101146131 (TGFBR2)
Cytokine receptors [BR:ggo04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   101146131 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 567 aa AA seqDB search
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFST
CDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPK
CIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAI
SVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcctgtggacgcgtatc
gccagcacgatcccaccgcacgttcagaagtcggttaataacgacatgatagtcactgac
aacaatggtgcagtcaagtttccacaactgtgtaaattttgtgatgtgagattttccacc
tgtgacaaccagaaatcctgcatgagcaactgcagcatcacctccatctgtgagaagcca
caggaagtctgtgtggctgtatggagaaagaatgacgagaacataacactagagacagtt
tgccatgaccccaagctcccctaccatgactttattctggaagatgctgcttctccaaag
tgcattatgaaggaaaaaaaaaagcctggtgagactttcttcatgtgttcctgtagctct
gatgagtgcaatgacaacatcatcttctcagaagaatataacaccagcaatcctgacttg
ttgctagtcatatttcaagtgacaggcatcagcctcctgccaccactgggagttgccata
tctgtcatcatcatcttctactgctaccgcgttaaccggcagcagaagctgagttcaacc
tgggaaaccggcaagacgcggaagctcatggagttcagcgagcactgtgccatcatcctg
gaagatgaccgctctgacatcagctccacgtgcgccaacaacatcaaccacaacacagag
ctgctgcccattgagctggacaccctggtggggaaaggtcgctttgctgaggtctataag
gccaagctgaagcagaacacttcagagcagtttgagacagtggcagtcaagatctttccc
tatgaggagtatgcctcttggaagacagagaaggacatcttctcagacatcaatctgaag
catgagaacatactccagttcctgacggctgaggagcggaagacggagttggggaaacag
tactggctgatcaccgccttccacgccaagggcaacctacaggagtacctgacgcggcat
gtcatcagctgggaggacctgcgcaagctgggcagctccctcgcccgggggattgctcac
ctccacagtgatcacactccatgtgggaggcccaagatgcccatcgtgcacagggacctc
aagagctccaatatcctcgtgaagaacgacctaacctgctgcctgtgtgactttgggctt
tccctgcgtctggaccctactctgtctgtggatgacttggctaacagtgggcaggtggga
actgcaagatacatggctccagaagtcctagaatccaggatgaatttggagaatgttgag
tccttcaagcagaccgatgtctactccatggctctggtgctctgggaaatgacatctcgc
tgtaatgcagtgggagaagtaaaagattatgagcctccatttggttccaaggtgcgggag
cacccctgtgtcgaaagcatgaaggacaacgtgttgagagatcgagggcgaccagaaatt
cccagcttctggctcaaccaccagggcatccagatggtgtgtgagacgttgactgagtgc
tgggaccacgacccagaggcccgtctcacagcccagtgtgtggcagaacgctttagtgaa
ctggagcatctggacaggctctcggggaggagctgctcggaggagaagattcctgaagac
ggctccctaaacactaccaaatag

DBGET integrated database retrieval system