KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101146540Help
Entry
101146540         CDS       T02442                                 

Gene name
SUV39H1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1 isoform 1
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101146540 (SUV39H1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101146540 (SUV39H1)
Chromosome [BR:ggo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101146540 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101146540 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
X
AA seq 412 aa AA seqDB search
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaaggctgcagcgtgtgttgcaagtcttcttggaatcagctgcag
gacctgtgccgcctggccaagctctcctgccctgccctcggtatctctaagaggaacctc
tatgactttgaagtcgagtacctgtgcgattacaagaagatccgcgaacaggaatattac
ctggtgaaatggcgtggatatccagactcagagagcacctgggagccacggcagaatctc
aagtgtgtgcgtatcctcaagcagttccacaaggacttagaaagggagctgctccggcgg
caccaccggtcaaagaccccccggcacctggacccaagcttggccaactacctggtgcag
aaggccaagcagaggcgggcgctccgtcgctgggagcaggagctcaatgccaagcgcagc
catctgggacgcatcactgtagagaatgaggtggacctggacggccctccgcgggccttc
gtgtacatcaatgagtaccgtgttggtgagggcatcaccctcaaccaggtggctgtgggc
tgcgagtgccaggactgtctgtgggcacccactggaggctgctgcccgggggcgtcactg
cacaagtttgcctacaatgaccagggccaggtgcggcttcgagccgggctgcccatctac
gagtgcaactcccgctgccgctgcggctatgactgcccaaatcgcgtggtacagaagggc
atccgatatgacctctgcatcttccgcacggatgatgggcgcggctggggcgtccgcacc
ctggagaagattcgcaagaacagcttcgtcatggagtacgtgggagagatcattacctca
gaggaggcagagcggcggggccagatctacgaccgtcagggcgccacctacctctttgac
ctggactacgtggaggacgtgtacaccgtggatgccgcctactatggcaacatctcccac
tttgtcaaccacagttgtgaccccaacctgcaggtgtacaacgtcttcatagacaacctt
gacgagcggctgccccgcatcgctttctttgccacaagaaccatccgggcaggcgaggag
ctcacctttgattacaacatgcaagtggaccccgtggacatggagagcacccgcatggac
tccaactttggcctggctgggctccctggctcccctaagaagcgggtccgtattgaatgc
aagtgtgggactgagtcctgccgcaaatacctcttctaa

DBGET integrated database retrieval system