KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101146540Help
Entry
101146540         CDS       T02442                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101146540 (SUV39H1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101146540 (SUV39H1)
Chromosome [BR:ggo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101146540 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101146540 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 101146540
NCBI-ProteinID: XP_004064151
Ensembl: ENSGGOG00000027774
UniProt: G3S7R4
Position
X
AA seq 412 aa AA seqDB search
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaaggctgcagcgtgtgttgcaagtcttcttggaatcagctgcag
gacctgtgccgcctggccaagctctcctgccctgccctcggtatctctaagaggaacctc
tatgactttgaagtcgagtacctgtgcgattacaagaagatccgcgaacaggaatattac
ctggtgaaatggcgtggatatccagactcagagagcacctgggagccacggcagaatctc
aagtgtgtgcgtatcctcaagcagttccacaaggacttagaaagggagctgctccggcgg
caccaccggtcaaagaccccccggcacctggacccaagcttggccaactacctggtgcag
aaggccaagcagaggcgggcgctccgtcgctgggagcaggagctcaatgccaagcgcagc
catctgggacgcatcactgtagagaatgaggtggacctggacggccctccgcgggccttc
gtgtacatcaatgagtaccgtgttggtgagggcatcaccctcaaccaggtggctgtgggc
tgcgagtgccaggactgtctgtgggcacccactggaggctgctgcccgggggcgtcactg
cacaagtttgcctacaatgaccagggccaggtgcggcttcgagccgggctgcccatctac
gagtgcaactcccgctgccgctgcggctatgactgcccaaatcgcgtggtacagaagggc
atccgatatgacctctgcatcttccgcacggatgatgggcgcggctggggcgtccgcacc
ctggagaagattcgcaagaacagcttcgtcatggagtacgtgggagagatcattacctca
gaggaggcagagcggcggggccagatctacgaccgtcagggcgccacctacctctttgac
ctggactacgtggaggacgtgtacaccgtggatgccgcctactatggcaacatctcccac
tttgtcaaccacagttgtgaccccaacctgcaggtgtacaacgtcttcatagacaacctt
gacgagcggctgccccgcatcgctttctttgccacaagaaccatccgggcaggcgaggag
ctcacctttgattacaacatgcaagtggaccccgtggacatggagagcacccgcatggac
tccaactttggcctggctgggctccctggctcccctaagaagcgggtccgtattgaatgc
aagtgtgggactgagtcctgccgcaaatacctcttctaa

DBGET integrated database retrieval system