KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101146612Help
Entry
101146612         CDS       T02442                                 

Gene name
ART3
Definition
ecto-ADP-ribosyltransferase 3 isoform 1
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101146612 (ART3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 389 aa AA seqDB search
MKTGHFEIVTMLLATMILVDIFQVKAEVLDMADNAFDDEYLKCTDRMEIKYVPQLLKEEK
ASHQQLDTVWENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVK
MAGQSREDYIYGFQFKAFHFYLTRALQLLRRPCETSSKNVVYRTSQGTSFTFGGLNQARF
GHFTLAYSAKPQAANDQLTVLSIYTCLGVDIENFLDKESERITLIPLNEVFQVSQEGAGN
NLILQSINKTCSHYECAFLGGLKTENCIENLEYFQPIYVYNPGEKNQKLEDHSEKNWKLE
DHGEKNQKLEDHGVKILEPTQIPGMKIPEPFPLPEDKSQRNINNPTPGPVPVPGPKSHPS
ASSGKLLLSQFGMVIILISVSAINLFVAL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgggacattttgaaatagtcaccatgctgctggcaaccatgattctagtggac
attttccaggtgaaggctgaagtgttagacatggcagataatgcatttgatgatgaatac
ctgaaatgtacggacaggatggaaattaaatacgttccccaactgctaaaggaggaaaaa
gcaagccaccagcaattagatactgtgtgggaaaatgcaaaagccaaatgggcagcccga
aagactcaaatctttctccctatgaattttaaggataaccatggaatagccctgatggca
tatatttccgaagctcaagagcaaactcccttttaccatctgttcagtgaagctgtgaag
atggctggccaatctcgagaagattatatctatggcttccagttcaaagctttccacttt
tacctcacaagagccctgcagttgctgagaagaccttgtgagaccagttccaaaaatgtg
gtatatagaacaagccagggcacttcatttacatttggagggctaaaccaagccaggttt
ggccattttaccttggcatattcagccaaacctcaggctgctaatgaccagctcactgtg
ttatccatctacacatgccttggagttgacattgaaaattttcttgataaagaaagtgaa
agaattactttaatacctctgaatgaggtttttcaagtgtcacaggaaggggctggcaat
aaccttatccttcaaagcataaacaagacctgcagccattatgagtgcgcatttctaggt
ggactaaaaaccgaaaactgtattgagaacctagaatattttcaacccatctatgtctac
aaccctggtgagaaaaaccagaagcttgaagaccatagtgagaaaaactggaagcttgaa
gaccatggtgagaaaaaccagaagcttgaagaccatggtgtgaaaatccttgaacccacc
caaatacctggaatgaaaattccagaaccttttccactacctgaagataaaagtcaaaga
aatatcaacaatcctactccaggtccagttcctgttccaggtcccaaaagccatccttct
gcatcctcgggcaaactgctgctttcacagtttgggatggtcatcattttaatcagtgtt
tctgctataaatctctttgttgctctgtag

DBGET integrated database retrieval system