KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101146743Help
Entry
101146743         CDS       T02442                                 

Gene name
ARG1
Definition
(RefSeq) arginase 1
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00220  Arginine biosynthesis
ggo00330  Arginine and proline metabolism
ggo01100  Metabolic pathways
ggo01230  Biosynthesis of amino acids
ggo05146  Amoebiasis
Module
ggo_M00029  Urea cycle
ggo_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    101146743 (ARG1)
   00330 Arginine and proline metabolism
    101146743 (ARG1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    101146743 (ARG1)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     101146743 (ARG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 101146743
NCBI-ProteinID: XP_004044730
Ensembl: ENSGGOG00000000977
UniProt: G3RRL0
Position
6
AA seq 322 aa AA seqDB search
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPN
DSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGV
IWVDAHSDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEGTLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAIT
LACFGVAREGNHKPIDYLNPPK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccaagtccagaaccatcgggattattggagctcctttctcaaagggacagcca
cgaggaggggtggaagaaggccctacagtattgagaaaggctggtctgcttgagaaactt
aaagaacaagagtgtgatgtgaaggattatggggacctgccctttgctgacatccctaat
gacagtccctttcaaattgtgaagaatccaaggtctgtgggaaaagcaagcgagcagctg
gctggcaaggtggcagaagtcaagaagaacggaagaatcagcctggtgctgggcggagac
cacagtttggcaattggaagcatctctggccatgccagggtccaccctgatcttggagtc
atctgggtggatgctcacagtgatatcaacactccgctgacaaccacaagtggaaacttg
catggacaacctgtatctttcctcctgaaggaactaaaaggaaagattcccgatgtgcca
ggattctcctgggtgactccctgcatatctgccaaggatattgtgtatattggcttgaga
gacgtggaccctggggaacactacattttgaaaactctaggcattaaatacttttcaatg
actgaagtggacagactaggaattggcaaggtgatggaaggaacactcagctatctacta
ggaagaaagaaaaggccaattcatctaagttttgatgttgacggactggacccatctttc
acaccagctactggcacaccagtcgtgggaggtctgacatacagagaaggtctctacatc
acagaagaaatctacaaaacagggctactctcaggattagatataatggaagtgaaccca
tccctggggaagacaccagaagaagtaactcgaacagtgaacacagcagtagcaataacc
ttggcttgtttcggagttgctcgggagggtaatcacaagcctattgactaccttaaccca
cctaagtaa

DBGET integrated database retrieval system