KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101146989Help
Entry
101146989         CDS       T02442                                 

Gene name
TMX3
Definition
protein disulfide-isomerase TMX3
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101146989 (TMX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 454 aa AA seqDB search
MAAWKSWTALRLCATVVVLDMVVCKGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLE
PIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKD
DIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYF
FSASEEVVPEYVTLKEMPAVLVFKDETYFVYDEYEDGDLSSWINRERFQNYLAMDGFLLY
ELGDTGKLVALAVIDEKNTSVEHTRLKSIIQEVARDYRDLFHRDFQFGHMDGNDYINTLL
MDELTVPTVVVLNTSNQQYFLLDRQIKNVEDMVQFINNILDGTVEAQGGDSILQRLKRIV
FDAKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTADTDGGYIEERYEVSKSENENQ
EQIEESKEQQEPSSGGSVVPTVQEPKDVLEKKKD
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgtggaagagttggacggccctgcggctctgcgccacagttgttgtacttgat
atggtcgtctgtaaaggatttgtagaagatttagatgaatcgtttaaagaaaatcgaaat
gatgacatttggcttgtagatttttatgcaccatggtgtggccattgtaaaaagctggaa
ccgatttggaatgaagttggtcttgagatgaaaagcattggttctccagttaaggttgga
aagatggatgctacttcctattccagcattgcttcagagtttggagttcgaggttatcca
acaattaagctattaaaaggggacttggcatataattatagaggaccacgaacaaaagat
gatattattgagtttgctcacagagtatctggggctctaattcggccacttccaagtcaa
caaatgtttgaacatatgcagaagagacaccgtgtatttttcgtttatgtaggtggagaa
tcacctttgaaagagaaatacatagatgctgcttcagaattgattgtatatacatacttc
ttttctgcctcagaggaagtggttcctgagtatgtgacactaaaagagatgccggctgtg
cttgttttcaaagatgaaacttactttgtttatgatgagtatgaagatggtgatctgtca
tcatggatcaacagggaaaggtttcagaattaccttgctatggatggcttcctcttgtat
gaacttggagacacaggaaagcttgtggctcttgcagttattgatgagaaaaatacatca
gttgaacataccagattgaagtcaattattcaggaagttgcaagagattacagagacctc
ttccatagggattttcagtttggccacatggatggaaatgactacataaataccttgctg
atggatgaattgacagtcccaactgtagttgtactgaatacttcaaaccagcaatatttc
ttgctagatagacagattaagaatgttgaagacatggtccagtttattaataacattttg
gatggcacagtagaagcccaaggaggtgatagcattttgcagagattgaaaaggatagta
tttgatgccaaatctactattgtgtctatattcaagagctcaccactgatgggctgcttt
ctctttggcctgccactgggtgtcatcagtatcatgtgctatggaatctacacagccgac
acagatggaggttatatagaagaacgatatgaagtgtctaaaagtgaaaatgaaaaccaa
gaacagatagaagagagcaaagaacagcaggagcccagcagtggaggatctgtagtgcct
acagtgcaggagcccaaggacgtattagaaaagaagaaagattga

DBGET integrated database retrieval system