KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101147742Help
Entry
101147742         CDS       T02442                                 

Gene name
GPT
Definition
alanine aminotransferase 1 isoform 1
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101147742 (GPT)
   01210 2-Oxocarboxylic acid metabolism
    101147742 (GPT)
   01230 Biosynthesis of amino acids
    101147742 (GPT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101147742 (GPT)
Enzymes [BR:ggo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101147742 (GPT)
Amino acid related enzymes [BR:ggo01007]
 Aminotransferase (transaminase)
  Class I
   101147742 (GPT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 496 aa AA seqDB search
MASSTGDRSQAVRNGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPF
TEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSL
GAYSVSSGIQLIREDVARYIERRDGGIPADPKNVFLSTGASDAIVTVLKLLVAGEGHTRT
GVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALCQARDHCRPRALCVI
NPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPY
AGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDL
VVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQL
PPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLL
LEKLSRFHAKFTLEYS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgagcacaggtgaccggagccaggcggtgaggaatggactgagggcgaaggtg
ctgacgctggacggcatgaacccacgcgtgcggagagtggagtacgcggtgcgtggcccc
atagtgcagcgagccttggagctggagcaggagctgcgccagggtgtgaagaagcctttc
accgaggtcatccgtgccaacatcggggacgcacaggctatggggcagaggcccatcacc
ttcctgcgccaggtcttggccctctgtgttaaccctgatcttctgagcagccccaacttc
cctgacgatgccaagaaaagggcggagcgcatcctgcaggcgtgtgggggccacagtctg
ggggcctacagcgtcagctccggcatccagctgatccgggaggacgtggcgcggtacatt
gagaggcgtgacggaggcatccctgcggaccccaaaaatgtcttcctgtccacaggggcc
agcgatgccatcgtgacggtgctgaagctgctggtggccggcgagggccacacgcgcacg
ggtgtgctcatccccatcccccagtacccactctactcggccacgctggcagagctgggc
gcagtgcaggtggattactacctggacgaggagcgtgcctgggcgctggacgtggccgag
cttcaccgtgcactgtgccaggcgcgtgaccactgccgccctcgtgcgctctgtgtcatc
aaccccggcaaccccaccgggcaggtgcagacccgcgagtgcatcgaggccgtgatccgc
ttcgccttcgaagagcggctctttctgctggcggacgaggtgtaccaggacaacgtgtac
gccgcgggctcgcagttccactcattcaagaaggtgctcatggagatggggccgccctac
gccgggcagcaggagcttgcctccttccactccacctccaagggctacatgggcgagtgc
gggttccgcggcggctatgtggaggtggtgaacatggacgccgcagtgcagcagcagatg
ctgaagctgatgagtgtgcggctgtgcccgccggtgccaggacaggccctgctggacctg
gtggtcagcccgcccgcgcccaccgacccctcctttgcacagttccaggctgagaagcag
gcagtgctggcagagctggcggccaaggccaagctcaccgagcaggtcttcaatgaggct
cctggcatcagctgcaacccagtgcagggcgccatgtactccttcccgcgcgtgcagctg
cccccgcgggcggtggagcgcgctcaggagctgggcctggcccccgatatgttcttctgc
ctgcgcctcctggaggagaccggcatttgcgtggtgccagggagcggctttgggcagcgg
gaaggcacctaccacttccggatgaccattctgccccccttggagaaactgcggctgctg
ctggagaagctgagcaggttccatgccaagttcaccctcgagtactcctga

DBGET integrated database retrieval system