KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101147913Help
Entry
101147913         CDS       T02442                                 

Gene name
RNASE2
Definition
(RefSeq) non-secretory ribonuclease
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 161 aa AA seqDB search
MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMRVINNY
QRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNI
SNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggttccaaaactgttcacttcccaaatttgtctgcttcttctgttggggcttctggca
gtggagggctcactccatgtcaaacctccacagtttacctgggctcaatggtttgaaacc
cagcacatcaatatgacctcccagcaatgcaccaatgcaatgcgggtcattaacaattat
caacggcgatgcaaaaaccaaaatactttccttcttacaacttttgctaacgtagttaat
gtttgtggtaacccaaatatgacctgtcctagtaacaaaactcgcaaaaattgtcatcac
agtggaagccaggtgcctttaatccactgtaacctcacaactccaagtccacagaatatt
tcaaactgcaggtatgcgcagacaccagcaaacatgttctatatagttgcatgtgacaac
agagatcaacgacgggaccctccacagtatccagtggttccagttcacctggatagaatc
atctaa

DBGET integrated database retrieval system