KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101147913Help
Entry
101147913         CDS       T02442                                 

Gene name
RNASE2
Definition
non-secretory ribonuclease
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     101147913 (RNASE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 161 aa AA seqDB search
MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMRVINNY
QRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNI
SNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggttccaaaactgttcacttcccaaatttgtctgcttcttctgttggggcttctggca
gtggagggctcactccatgtcaaacctccacagtttacctgggctcaatggtttgaaacc
cagcacatcaatatgacctcccagcaatgcaccaatgcaatgcgggtcattaacaattat
caacggcgatgcaaaaaccaaaatactttccttcttacaacttttgctaacgtagttaat
gtttgtggtaacccaaatatgacctgtcctagtaacaaaactcgcaaaaattgtcatcac
agtggaagccaggtgcctttaatccactgtaacctcacaactccaagtccacagaatatt
tcaaactgcaggtatgcgcagacaccagcaaacatgttctatatagttgcatgtgacaac
agagatcaacgacgggaccctccacagtatccagtggttccagttcacctggatagaatc
atctaa

DBGET integrated database retrieval system