KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101148280Help
Entry
101148280         CDS       T02442                                 

Gene name
PDIA2
Definition
protein disulfide-isomerase A2
Orthology
K09581  
protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101148280 (PDIA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 525 aa AA seqDB search
MSRQLLPVLLLLLLRASCPWGQEQGARSPSEEPPEEEIPKEDGILVLSRHTLGLALREHP
ALLVEFYAPWCGHCQALAPEYSKAAAVLAAESTVVTLAKVDGPAQRELAEEFGVTEYPTL
KFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLEDEAAAQALIGGRDLVVIGFFQ
DLQDEDVATFLALAQDALDITFGLTDRPRLFEQFGLTKDTVVLFKKFDEGRADFPVDEEL
GLDVGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEA
APRFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRLVNLETTKKYAPVDGGPVTAASI
TAFCHAVLNGQVKSYLLSQEIPPGWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTH
CKEMAPAWEALAEKYQDHEDIIIAELDATANELEAFVVHSFPTLKYFPAGPGRKVIEYKS
TRDLETFSKFLDNGGVLPMEEPPEEPAAPFPEPPANSTMESKEEL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccagcttctgcccgtactgctgctgctgctgctcagggcttcgtgcccatgg
ggtcaggaacagggagccaggagcccctcggaggagcctccagaggaggaaatccccaag
gaagatgggatcttggtgctgagccgccacaccctgggcctggccctgcgggagcaccct
gccctgctggtggaattctatgccccgtggtgtgggcactgccaggccctggcccccgag
tacagcaaggcagctgccgtgctcgcggccgagtcaacggtggtcacgctggccaaggtg
gatgggcccgcgcagcgcgagctggctgaggagtttggtgtgacggagtaccctacgctc
aagttcttccgcaatgggaaccgcacccacccggaggagtacacaggaccacgggacgct
gagggcattgccgagtggctgcgacggcgggtggggcccagtgccatgcggctggaggac
gaggcggccgcccaggcgctgatcggtggccgggacctagtggtcatcggcttcttccag
gacctgcaggacgaggacgtggccaccttcttggccctggcccaggacgccctggacatc
acctttggcctcacagaccggccgcggctctttgagcagtttggcctcaccaaggacact
gtggttctcttcaagaagtttgatgaggggcgggcagacttccccgtggacgaggagctt
ggcctggacgtgggggatctgtcgcgcttcctggtcacacacagcatgcgcctggtcacg
gagttcaacagccagacgtctgccaagatcttcgcggccaggatcctcaaccacctgctg
ctgtttgtcaaccagacgctggctgcgcaccgggagctcctagcgggctttggggaggca
gctccccgcttccgggggcaggtgctgttcgtggtggtggacgtggcagccgacaatgag
cacgtgctgcagtactttggcctcaaggctgaggcagcccccactctgcgcttggtcaac
cttgaaaccactaaaaagtatgcgcctgtggatggcggccctgtcactgcagcgtccatc
actgctttctgccatgcagtcctcaacggccaagtcaagtcctatctcctgagccaggag
ataccccctggttgggatcagcggccagttaagaccctcgtgggcaagaattttgagcag
gtggcttttgacgaaaccaagaatgtgtttgtcaagttctatgccccgtggtgcacccac
tgcaaggagatggcccctgcctgggaggcattggctgagaagtaccaagaccacgaggac
atcatcattgctgagctggatgccacagccaacgagctggaggccttcgtcgtgcacagc
ttccctaccctcaagtacttcccagcaggaccaggtcggaaggtgattgaatacaaaagc
accagggacctggagactttctccaagttcctggacaacgggggcgtgctgcccatggag
gagcccccggaggagccagcagccccgttcccggagccaccggccaactccactatggag
tccaaggaggaactgtag

DBGET integrated database retrieval system