KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101148438Help
Entry
101148438         CDS       T02442                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04010  MAPK signaling pathway
ggo04015  Rap1 signaling pathway
ggo04068  FoxO signaling pathway
ggo04071  Sphingolipid signaling pathway
ggo04218  Cellular senescence
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04370  VEGF signaling pathway
ggo04380  Osteoclast differentiation
ggo04550  Signaling pathways regulating pluripotency of stem cells
ggo04611  Platelet activation
ggo04620  Toll-like receptor signaling pathway
ggo04621  NOD-like receptor signaling pathway
ggo04622  RIG-I-like receptor signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04657  IL-17 signaling pathway
ggo04658  Th1 and Th2 cell differentiation
ggo04659  Th17 cell differentiation
ggo04660  T cell receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04668  TNF signaling pathway
ggo04670  Leukocyte transendothelial migration
ggo04714  Thermogenesis
ggo04722  Neurotrophin signaling pathway
ggo04723  Retrograde endocannabinoid signaling
ggo04728  Dopaminergic synapse
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04912  GnRH signaling pathway
ggo04914  Progesterone-mediated oocyte maturation
ggo04917  Prolactin signaling pathway
ggo04926  Relaxin signaling pathway
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo05014  Amyotrophic lateral sclerosis (ALS)
ggo05132  Salmonella infection
ggo05133  Pertussis
ggo05140  Leishmaniasis
ggo05142  Chagas disease (American trypanosomiasis)
ggo05145  Toxoplasmosis
ggo05152  Tuberculosis
ggo05160  Hepatitis C
ggo05164  Influenza A
ggo05167  Kaposi's sarcoma-associated herpesvirus infection
ggo05169  Epstein-Barr virus infection
ggo05205  Proteoglycans in cancer
ggo05418  Fluid shear stress and atherosclerosis
Module
ggo_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    101148438 (MAPK13)
   04010 MAPK signaling pathway
    101148438 (MAPK13)
   04370 VEGF signaling pathway
    101148438 (MAPK13)
   04668 TNF signaling pathway
    101148438 (MAPK13)
   04068 FoxO signaling pathway
    101148438 (MAPK13)
   04071 Sphingolipid signaling pathway
    101148438 (MAPK13)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    101148438 (MAPK13)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101148438 (MAPK13)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101148438 (MAPK13)
   04620 Toll-like receptor signaling pathway
    101148438 (MAPK13)
   04621 NOD-like receptor signaling pathway
    101148438 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    101148438 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    101148438 (MAPK13)
   04660 T cell receptor signaling pathway
    101148438 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    101148438 (MAPK13)
   04659 Th17 cell differentiation
    101148438 (MAPK13)
   04657 IL-17 signaling pathway
    101148438 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    101148438 (MAPK13)
   04670 Leukocyte transendothelial migration
    101148438 (MAPK13)
  Endocrine system
   04912 GnRH signaling pathway
    101148438 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    101148438 (MAPK13)
   04917 Prolactin signaling pathway
    101148438 (MAPK13)
   04926 Relaxin signaling pathway
    101148438 (MAPK13)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101148438 (MAPK13)
  Nervous system
   04728 Dopaminergic synapse
    101148438 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    101148438 (MAPK13)
   04722 Neurotrophin signaling pathway
    101148438 (MAPK13)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101148438 (MAPK13)
  Development
   04380 Osteoclast differentiation
    101148438 (MAPK13)
  Environmental adaptation
   04714 Thermogenesis
    101148438 (MAPK13)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    101148438 (MAPK13)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    101148438 (MAPK13)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101148438 (MAPK13)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101148438 (MAPK13)
  Infectious diseases
   05132 Salmonella infection
    101148438 (MAPK13)
   05133 Pertussis
    101148438 (MAPK13)
   05152 Tuberculosis
    101148438 (MAPK13)
   05164 Influenza A
    101148438 (MAPK13)
   05160 Hepatitis C
    101148438 (MAPK13)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101148438 (MAPK13)
   05169 Epstein-Barr virus infection
    101148438 (MAPK13)
   05145 Toxoplasmosis
    101148438 (MAPK13)
   05140 Leishmaniasis
    101148438 (MAPK13)
   05142 Chagas disease (American trypanosomiasis)
    101148438 (MAPK13)
  Drug resistance
   01522 Endocrine resistance
    101148438 (MAPK13)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101148438 (MAPK13)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101148438 (MAPK13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Haspin_kinase Kdo DUF4023 DUF3231
Motif
Other DBs
NCBI-GeneID: 101148438
NCBI-ProteinID: XP_004043935
Ensembl: ENSGGOG00000003947
UniProt: G3QMX6
Position
6
AA seq 365 aa AA seqDB search
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcatccggaaaaagggcttctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctatggctccgtgtgc
tcggccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccgacccttt
cagtccgagatcttcgccaagcgcgcctaccgggagctgctgctgctgaagcacatgcag
catgagaacgtcatcgggctcctggatgtcttcaccccagcctcctccctgcgcaacttc
catgacttctacctggtgatgcccttcatgcagacggatctgcagaagatcatggggatg
gagttcagtgaggagaagatccagtacctggtgtatcagatgctcaaaggccttaagtac
atccactctgctggggtcgtgcacagggacctgaagccaggcaacctggctgtgaatgag
gactgtgaactgaagattctggattttgggctggcacgacatgcagacgccgagatgact
ggctacgtggtgacccgctggtaccgagcccccgaggtgatcctcagctggatgcactac
aaccagacagtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaaa
actctgttcaaggggaaagattacctggaccagctgacccagatcctgaaagtgaccggg
gtgcctggcacggagtttgtgcagaagctgaacgacaaagcggccaaatcctacatccag
tccctgccacagacccccaggaaggatttcactcagctgttcccacgggccagcccccag
gctgcggacctgctggagaagatgctggagctagacgtggacaagcgcctgacggccgcg
caggccctcacccatcccttctttgaacccttccgggaccctgaggaagagacggaggcc
cagcagccgtttgatgattccttagaacacgagaaactcacagtggatgaatggaagcag
cacatctacaaggagattgtgaacttcagccccattgcccggaaggactcacggcgccgg
agtggcatgaagctgtag

DBGET integrated database retrieval system