KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101148487Help
Entry
101148487         CDS       T02442                                 

Gene name
UROS
Definition
(RefSeq) uroporphyrinogen-III synthase
  KO
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101148487 (UROS)
Enzymes [BR:ggo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     101148487 (UROS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 265 aa AA seqDB search
MKVLLLKDAKEDDCGQDPYIRELGLYGLEATLIPVLSFEFLSLPSFSEKLSHPEDYEGLI
FTSPRAVEAAELCLEQNNKTEVWERSLKEKWNAKSVYVVGNATASLVSKIGLDTEGAACG
NAEKLAEYICSRESSALPLLFPCGNLKREILPKALKDKGIAMESITVYQTIAHPGIQGNL
NSYYSQQGVPASITFFSPSGLTYSLKHIQELSGDNIDQIKFAAIGPTTARALAAQGLPVS
CTAESPTPQALATGIRKALQPHGCC
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttcttttactgaaggatgcgaaggaagatgactgtggccaggatccgtatatc
agggaattaggattatatggacttgaagccactttgatccctgttttatcatttgagttt
ttgtctcttcccagtttctctgagaagctttctcatcctgaagattacgagggactcatt
tttaccagccccagagcagtggaagcagcagagttatgtttggagcaaaacaataaaact
gaagtctgggaaaggtctctgaaagaaaaatggaatgccaagtcagtgtatgtggttgga
aatgctactgcttctctagtgagtaaaattggcctggatacagaaggagcagcctgtgga
aatgcagaaaagcttgcagaatatatttgttccagggagtcctcagcactgcctcttcta
tttccctgtggaaacctcaaaagagaaatcctgccaaaagcgctcaaggacaaagggatt
gccatggaaagcataactgtgtatcagacaattgcacacccaggaatccaagggaacctg
aacagctactattcccagcagggggttccagccagcatcacgttttttagtccctctggc
ctcacatacagtcttaagcacattcaggagttatctggtgacaatatcgatcaaattaag
tttgcagccatcggccccactacggctcgcgcgctggccgcccagggccttcctgtaagc
tgcactgcagagagccccacgccacaagccctggccactggcatcaggaaggctctccag
ccccatggctgctgctga

DBGET integrated database retrieval system