KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101148846Help
Entry
101148846         CDS       T02442                                 

Gene name
TYR
Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    101148846 (TYR)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    101148846 (TYR)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    101148846 (TYR)
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     101148846 (TYR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 471 aa AA seqDB search
MLLAILYCLLWSFQTSAGHFPRACVSSKNLMEKECCPPWSGDRSPCGQLSGRGSCQNILL
SNAPLGPQFPFTGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFWGPNCTERRLLVR
RNIFDLSAPEKDKFFAYLTLAKHTISSDYVIPIGTYGQMKNGSTPMFNDINIYDLFVWMH
YYVSMDALLGGSEIWRDIDFAHEAPAFLPWHRLFLLRWEQEIQKLTGDENFTIPYWDWRD
AEKCDICTDEYMGGQHPTNPNLLSPASFFSSWQIVCSRLEEYNSHQSLCNGTPEGPLQRN
PGNHDKSRTPRLPSSADVEFCLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQS
SMHNALHIYMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHRPLQEVYPEANAPIGH
NRESYMVPFIPLYRNSDFFISSKDLGYDYSYLQDSVSEWILFTTKATKFPG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggctattttgtactgcctgctgtggagtttccagacctccgctggccatttc
cctagagcctgtgtctcctctaagaacctgatggagaaggaatgctgtccaccgtggagc
ggggacaggagtccctgtggccagctttcaggcagaggttcctgtcagaatatccttctg
tccaatgcaccacttgggcctcaatttcccttcacaggggtggatgaccgggagtcgtgg
ccttccgtcttttataataggacctgccagtgctctggcaacttcatgggattcaactgt
ggaaactgcaagtttggcttttggggaccaaactgcacagagagacgactcttggtgaga
agaaacatcttcgatttgagtgccccagagaaggacaaattttttgcctacctcacttta
gcaaagcataccatcagctcagactacgtcatccccatagggacctatggccaaatgaaa
aatggatcaacacccatgtttaacgacatcaatatttatgacctctttgtctggatgcat
tattatgtgtcaatggatgcactgcttgggggatctgaaatctggagagacattgatttt
gcccatgaagcaccagcttttctgccctggcatagactcttcttgttgcggtgggaacaa
gaaatccagaagctgacaggagatgaaaacttcactattccatattgggactggcgggat
gcagaaaagtgtgacatttgcacagatgagtacatgggaggtcagcaccccacaaatcct
aacttactcagcccagcatcattcttctcctcttggcagattgtctgtagccgattggag
gagtacaacagccatcagtctttatgcaatggaacgcccgagggacctttgcagcgtaat
cctggaaaccatgacaaatccagaaccccaaggctcccctcttcagctgatgtagaattt
tgcctgagtttgacccaatatgaatctggttccatggataaagctgccaatttcagcttc
agaaatacactggaaggatttgctagtccacttactgggatagcagatgcctctcaaagc
agcatgcacaatgccttgcacatctatatgaatggaacaatgtcccaggtacagggatct
gccaacgatcccatcttccttcttcaccatgcatttgttgacagtatttttgagcagtgg
ctccgaaggcaccgtcctcttcaagaagtttatccggaagccaatgcacccattggacat
aaccgggaatcctacatggttccttttataccactgtacagaaacagtgatttctttatt
tcatccaaagatctgggctatgactatagctatctacaagattcagtgtccgaatggata
ctttttactacaaaggcaacaaaatttcctggatga

DBGET integrated database retrieval system