KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101148975Help
Entry
101148975         CDS       T02442                                 

Gene name
GLS2
Definition
glutaminase liver isoform, mitochondrial
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101148975 (GLS2)
   00330 Arginine and proline metabolism
    101148975 (GLS2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101148975 (GLS2)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    101148975 (GLS2)
  Nervous system
   04724 Glutamatergic synapse
    101148975 (GLS2)
   04727 GABAergic synapse
    101148975 (GLS2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    101148975 (GLS2)
   05206 MicroRNAs in cancer
    101148975 (GLS2)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     101148975 (GLS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 602 aa AA seqDB search
MRSMKALQKALSRAGSHCGRGGWGHPSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQD
HDSSESGMLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSEMHRVVQ
ESSSGGLLDRDLFRKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDVKELTGGKVA
AYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKVPFCLQSCVKPLTYAISISTLGTDYVHK
FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
NEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCLSPPLDKLGNSHRGTSFCQKLVSLFNFHNYDNLRHCARKLDPRREGA
EVRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIE
ACKVNPFVKDRWGNIPLDDAVQFNHLEMVKLLQDYQDSYTLPETQAEAAAEALSKENLES
MV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccatgaaggctctgcagaaggccctgagccgggctggcagtcactgcgggcga
ggaggctggggtcacccgagccggagccccctccttggcgggggcgtccggcaccacctc
agtgaggccgcggcgcagggcagagagacgccacacagccaccagccgcagcaccaggat
catgattcatcagaaagtggcatgctgtcccgcctgggtgatttgctcttttacactatt
gctgaaggacaggaacgaatccctatccacaagttcaccactgcactaaaggccactgga
ctgcagacatcagatcctcggctccgagactgcatgagtgagatgcaccgtgtggtccaa
gagtccagtagtggtggcctcttggaccgagatctcttccgaaagtgtgtgagcagcaac
attgtgctcctgacccaggcattccgaaagaagtttgtcattcctgattttgaggagttc
acgggccatgtggatcgcatctttgaggatgtcaaagagctcactggaggcaaagtggca
gcctacatccctcagctggccaagtcaaacccagacctgtggggtgtctccctgtgcact
gtggatggtcagcggcactctgtgggccacacaaaggtccccttctgcctgcagtcctgt
gtgaagcccctcacctatgccatctccataagcaccctaggcactgactacgtgcacaag
tttgtgggcaaagagccaagtggcctgcgctacaacaagctctccctcaatgaggaagga
atcccccataaccccatggtcaatgctggtgccattgttgtcagctccctgatcaagatg
gactgtaacaaagcagagaagtttgattttgtgttgcagtatctcaacaaaatggctggg
aatgaatacatgggtttcagcaatgccacattccagtcagagaaggaaacaggggatcgg
aattatgccatcggctattatctcaaggaaaagaagtgctttcctaagggggtggacatg
atggctgcccttgatctctacttccagctgtgctctgtggaggtcacttgtgaatcaggc
agtgtcatggcagccaccctagccaatggtgggatctgccccatcacaggcgagagtgtg
ctgagtgctgaagcagtgcgcaacaccctcagcctcatgcattcctgcggcatgtatgac
ttctctggccagtttgccttccacgtgggcctgccagccaagtcagctgtatcaggagcc
atcctcctggtggtacccaatgtcatgggaatgatgtgcctgtcacccccattggacaag
ctggggaacagccatagggggaccagcttctgccagaagttggtgtctctcttcaatttc
cacaactatgacaacctgaggcactgtgctcggaagttagacccacggcgtgaaggggca
gaagttcggaacaagactgtggtcaacctgttatttgctgcctatagtggcgatgtctca
gctcttcgaaggtttgccttgtcagccatggatatggaacagaaagactatgactcgcgc
acagctctgcatgttgctgcagctgaaggacacatcgaagttgttaaattcctgatcgag
gcttgcaaagtgaatccttttgtcaaggacaggtggggcaacattcccctggatgatgct
gtgcagttcaaccatctggagatggtcaaactgcttcaggattaccaggactcctacaca
ctccctgagactcaggctgaggcagctgctgaggccctgtccaaagagaacttagaaagc
atggtatga

DBGET integrated database retrieval system