KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101148988Help
Entry
101148988         CDS       T02442                                 

Gene name
PDIA5
Definition
protein disulfide-isomerase A5 isoform 1
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101148988 (PDIA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 519 aa AA seqDB search
MAQAGPAWLLLAIWVVLPSWLSSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEAAA
ENHLRLLSTVAQVVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHT
EYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAP
WCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLF
QYDNYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMF
HAPWCGHCKKMKPEFEKAAEALHGEADSSGVLAAVDATVNKALAERFHISEFPTLKYFKN
GEKYAVPVLRTKKKFLEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNFRETLKKKKHTLVM
FYAPWCPHCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYH
YGKFAEKYDSDRTELGFTNYIRALREGDHERLGKKKEEL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggccgggccggcgtggctgctgctggcaatctgggtggtcctgccatcatgg
ctgtcctctgcaaaggtctcctcgctcattgagagaatctctgaccccaaggacttgaaa
aaactgctcagaacccggaataatgtactggtgctttactccaaatctgaggcggcagct
gaaaatcatctcaggttactgtccacagtggcccaggtggtgaaaggacaagggaccatc
tgctgggtggactgtggtgatgcagagagtagaaaattgtgcaagaagatgaaagttgac
ctgagcccgaaggacaaaaaggtcgaattattccattaccaggatggtgcatttcatact
gaatataaccgagctgtgacatttaagtccatagtggcctttttgaaggatccaaaaggg
cccccactgtgggaggaagatcctggagccaaagatgttgtccaccttgacagtgaaaag
gacttcagacggctcctgaagaaggaagagaagccgctcttgatcatgttttatgccccc
tggtgcagcatgtgcaagaggatgatgccgcatttccagaaggctgcgactcagctgcgg
ggccacgccgtgctggccgggatgaatgtctactcctctgaatttgaaaacatcaaggag
gagtacagcgtgcgcggcttccccaccatctgctattttgagaaaggacggttcttgttc
cagtatgacaactatgggtccacagctgaggacattgtggagtggctgaagaatccgcag
ccgccacagccccaggtccctgagactccctgggcagatgagggcggctccgtttatcac
ctgaccgatgaagactttgaccagtttgtgaaagaacactcctctgtcctcgtcatgttc
cacgccccatggtgtggccactgtaagaaaatgaagccggagtttgagaaggcagcagaa
gccctccatggagaagcggatagctctggtgtccttgcagctgtcgatgccactgtcaac
aaggccctggcagaaagattccacatctcagagtttcctacgttgaagtattttaagaat
ggagagaaatacgcagtgcccgtgctcaggacaaagaagaagtttctcgagtggatgcaa
aaccctgaggcccccccgcccccagagcccacgtgggaagagcagcagacaagcgtgttg
cacctggtgggggacaacttccgggagaccctgaagaagaagaaacacaccttggtcatg
ttctacgccccttggtgcccacactgtaagaaggtcattccgcactttactgctactgct
gatgccttcaaagatgaccgaaagattgcctgtgccgctgttgactgtgtcaaagacaag
aaccaagacctgtgccagcaggaggcggtcaagggctaccccactttccactactaccac
tatgggaagttcgcagaaaagtatgacagcgaccgcacagaattgggatttaccaattat
attcgagccctccgggagggagaccatgaaagactagggaaaaagaaggaagagttataa

DBGET integrated database retrieval system