KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101149966Help
Entry
101149966         CDS       T02442                                 

Gene name
CES1
Definition
(RefSeq) liver carboxylesterase 1
  KO
K01044  carboxylesterase 1 [EC:3.1.1.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00983  Drug metabolism - other enzymes
ggo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101149966 (CES1)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     101149966 (CES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Esterase Peptidase_S9 Say1_Mug180
Motif
Other DBs
NCBI-GeneID: 101149966
NCBI-ProteinID: XP_018867100
Ensembl: ENSGGOG00000016469
Position
16
AA seq 628 aa AA seqDB search
MWLRALVLGTVAASTAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAVFLGIPFAKPPL
GPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQFLSELLTNRKENIPLRVSEDCLYLN
IYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFST
GDEHSPGNWGHLDQLAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLF
HRAISESGVALTSVLVKKGDVKPLAKQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLK
MKFLSLDLQGDPRESEPLLGTVIDGMLLLKTPEELQAERNFHTVPYMVGINKQEFGWLIP
MLMSYPLSEGKLDQKTAMSLLWKSYPLVCIAKELIAEATEKYLGGTDDPVKKKDLFLDLI
ADVMFGVPSVIVARNHRVTDQMGLTPWLLRTHQCLWASHCACLGALRLCCFSECELWVCA
GEGEKTQERATLESGVAVEETLGWGISCDPERGGGRRGSQETKAASQWNDACPLLSPRSD
MLKEGASEEEIRLSKMVMKFWANFARNGNPNGDFLPHWPEYNQKEGYLQIGANTQTAQKL
KDKEVAFWTNLFAKKAVEKPPQTEHIEL
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtggctccgtgctcttgtcctgggcactgtcgccgcttccacggcttgggggcatccg
tcctcgccacctgtggtggacactgtgcatggcaaagtgctggggaagttcgtcagctta
gaaggatttgcacagcctgtggccgttttcctgggaatcccttttgccaagccccctctt
ggacccctgaggtttactccaccgcagcctgcagaaccgtggagctttgtgaagaatgcc
acctcgtaccctcctatgtgcacccaagatcccaaggcagggcagtttctctcagagcta
ttgacgaacagaaaagagaacattcctctcagggtttctgaagactgtctttacctcaat
atttacactcctgctgacttgaccaagaaaaacaggctgccggtgatggtgtggatccat
ggaggggggctgatggtgggtgcagcatcaacctatgatgggctggcccttgctgcccat
gaaaacgtggtggtggtgaccattcaatatcgcctgggcatctggggattcttcagcaca
ggggatgaacacagcccagggaactggggtcacctggaccagctggctgccctgcgctgg
gtccaggacaacattgccagctttggagggaacccaggctctgtgaccatctttggagag
tcagcgggaggagaaagtgtctctgttcttgttttgtctccattggccaagaacctcttc
caccgggccatttctgagagtggcgtggccctcacttctgttctggtgaagaaaggtgat
gtcaagccattggctaagcaaattgctatcactgctgggtgcaaaaccaccacctcagct
gtcatggttcactgcctgcgacagaagacggaagaggagctcttggagacgacattgaaa
atgaaattcttatctctggacttacagggagaccccagagagagtgaaccccttctgggc
actgtgattgatgggatgctgctgctgaaaacacctgaagagcttcaagctgaaaggaat
ttccacactgtcccctacatggtcggaattaacaagcaggagtttggctggttgattcca
atgttgatgagctatccactctccgaagggaaactggaccagaagacagccatgtcactc
ttatggaagtcctatccccttgtttgcattgctaaggaactgattgcagaagccactgag
aaatacttaggaggaacagacgaccctgtcaaaaagaaagacctgttcctggacttgata
gcagatgtgatgtttggtgtcccatctgtgattgtggcccggaaccacagagttacagat
cagatgggactcaccccatggctgctcagaacgcaccagtgcctctgggcatctcactgt
gcatgcctaggcgccttgcggctctgttgtttttcagaatgtgaattgtgggtgtgtgct
ggggagggagaaaagacccaagagagagcaaccctggaaagtggggttgctgtagaggaa
accctggggtggggcatttcctgtgaccctgagcggggcggaggcaggcgagggtcacag
gagacaaaggcagccagccaatggaatgacgcatgcccattgctgagccctaggtcagat
atgctgaaagagggtgcctcagaagaggagatcagacttagcaagatggtgatgaaattc
tgggccaactttgctcgcaatggaaaccccaatggggactttctgccccactggccagag
tacaaccagaaggaagggtacctgcagattggtgctaacacccagacagcccagaagctg
aaggacaaggaagtagctttctggaccaacctctttgccaagaaggcagtggagaagcca
ccccagacagaacacatagagctgtga

DBGET integrated database retrieval system