KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101150328Help
Entry
101150328         CDS       T02442                                 

Gene name
CES5A
Definition
(RefSeq) carboxylesterase 5A
  KO
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     101150328 (CES5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
16
AA seq 575 aa AA seqDB search
MSGNWVHPRQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSPVPVNVFLGV
PFAAPPLGSLRFTNPQPASPWDNLXEATSYPNLXLQNSEWLLLDQHMLKVHYPKFGVSED
CLYLNIYASAHADAGSKLPIRLPAVLVWFPGHAFKTGSASIFDGSALAAYEDVLVVVVQY
RLGIFGFFTTWDQHAPGNWAFKDQVAALSWVQKNIEFFGGDPSSVTIFGESAGAISVSSL
ILSPMAKGLFHKAIIPYLKAHDYEKSEDLLVVAHFNASDSEALLRXRTKPSKELLTLSQK
TKSFTRVVDGAFFPNEPLDLLSQKAFKAIPSIIGVNNHECGFLLPMKEAPEILSGSNKSL
ALHLIQNILHIPPQYLHFVANEYFRDKHSLTEIRDSLLDLLGDVFFVVPALITAXYHRDA
GAPVYFYEFRHRPQCFEDTKPAFVKADYADEVRFVFGGAFLKGDVVMFEGATEEEKLLSR
KMMKYWATFARTGNPNGNDLSLWPAYNLTEQYLQLDLNMSLGQRLKEPQVEFWTSTIPLI
LSASDTLHRPLSSLTVLSLLQPFFFSCALXEVIFL
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggaattgggtgcacccacgccagatcctaatttgggctatctgggtccttgca
gcccccaccaaagggccttctgctgaagggccacagaggaacaccaggctgggatggatt
cagggcaagcaagtcaccgtgctgggaagccctgtgcctgtgaacgtgttcctcggagtc
ccctttgctgctcccccgctgggatccctgcgatttacgaacccgcagccggcatcgccc
tgggataacttgtgagaagccacctcctaccctaatttgtgactccagaactcagagtgg
ctgctcttagatcaacacatgctcaaggtgcattaccccaaatttggagtgtcagaagac
tgcctctacctgaacatctatgcgtctgcccacgccgatgcaggctccaagctccccata
aggctgcctgctgtcttggtgtggttcccagggcatgccttcaagactggctcagcctcc
atctttgatgggtccgccctggctgcctatgaggacgtgctggttgtggtcgtccagtac
cggctaggaatatttggtttcttcaccacatgggatcagcacgctccggggaactgggcc
ttcaaggaccaggtggctgctctgtcctgggtccagaagaacatcgagttcttcggtggg
gaccccagctctgtgaccatctttggcgagtccgcgggagccataagtgtttctagtctt
atactgtctcccatggccaaaggcttattccacaaagccatcatcccttacctgaaggcc
catgattatgagaagagtgaggacctgctggtggttgcacatttcaatgcgtcagactct
gaggccctgctgaggntgaggacaaaaccctccaaggagctgctgaccctcagccagaaa
acaaagtctttcactcgagtggttgatggtgctttctttcctaatgagcctctagatcta
ttgtctcagaaagcatttaaagcaattccttccatcatcggagtcaataaccacgagtgt
ggcttcctgctgcctatgaaggaggctcctgagatcctcagtggctccaacaagtccctt
gccctccatctgatacaaaacatcctgcacatcccgcctcagtatttgcactttgtggct
aatgaatacttccgtgacaagcactccctgactgaaatccgagacagtcttctggacttg
cttggagatgtgttctttgtggtccctgcactgatcacagcttgatatcacagagatgct
ggtgcacctgtctacttctatgagtttcggcaccggcctcagtgctttgaagacacgaag
ccagcttttgtcaaagccgactacgctgatgaagtccgctttgtgttcggtggtgccttc
ctgaagggtgacgttgttatgttcgaaggagccacggaggaggagaagttactgagccgg
aagatgatgaaatactgggctacctttgctcgaaccgggaatcctaatgggaacgacctg
tctctgtggccagcttataatctgactgagcagtacctgcagctggacttgaacatgagc
ctcggacagagactcaaagaaccgcaggtggagttttggaccagcaccatccccctgatc
ctgtctgcctccgacacgctccaccgtcctctttcttccttaactgtcctctctctcctc
cagcctttctttttctcttgtgctctttgagaagttatctttctgtga

DBGET integrated database retrieval system