KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101150696Help
Entry
101150696         CDS       T02442                                 

Gene name
LYZL6
Definition
lysozyme-like protein 6 isoform 1
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     101150696 (LYZL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 148 aa AA seqDB search
MTKALLIYLVSNFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNIS
KINENADGSFDYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGA
RGMNNWVEWRLHCSGQPLSYWLTGCRLR
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggcgctactcatctatttggtcagcaactttcttgccctaaatcaggccagc
ctcatcagtcgctgtgacttggcccaggtgctgcagctggaggacttggatgggtttgag
ggttactccctgagtgactggctgtgcctggcttttgtggaaagcaagttcaacatatca
aagataaatgaaaatgcagatggaagctttgactatggcctcttccagatcaacagccac
tactggtgcaacgattataagagttactcggaaaacctttgccacgtagactgtcaagat
ctgctgaatcccaaccttcttgcaggtatccactgcgcaaaaaggattgtgtccggagca
cgggggatgaacaactgggtagaatggaggttgcactgttcaggccagccactctcctac
tggctgacaggatgccgcctgagatga

DBGET integrated database retrieval system