KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101150887Help
Entry
101150887         CDS       T02442                                 

Gene name
CHKA
Definition
(RefSeq) choline kinase alpha
  KO
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Choline metabolism in cancer
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101150887 (CHKA)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    101150887 (CHKA)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     101150887 (CHKA)
    2.7.1.82  ethanolamine kinase
     101150887 (CHKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
11
AA seq 168 aa AA seqDB search
MLFQCSLPDTTATLGDEPRKVLLRLYGAILQMRSCNKEGSEQAQKENEFQGAEAMVLESV
MFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEIAEKMATFHGMKMPF
NKEPKWLFGTMEKYLKEVLRIKFTEESRIKKLHRLLSYNLPLELENLR
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgctgttccagtgctccctacctgacaccacagccacccttggcgatgagcctcggaaa
gtgctcctgcggctgtatggagcgattttgcagatgaggtcctgtaataaagagggatcc
gaacaagctcagaaagaaaatgaatttcaaggggccgaggccatggttctggagagcgtt
atgtttgccattctcgcagagaggtcacttgggccaaaactctatggcatctttccccaa
ggccgactggagcagttcatcccgagccggcgattagatactgaagaattaagtttgcca
gatatttctgcagaaatcgccgagaaaatggctacatttcatggtatgaaaatgccattc
aataaggaaccaaaatggctttttggcacaatggaaaagtatctaaaggaagtactgaga
attaaatttactgaggaatccagaattaaaaagctccacagattgctcagttacaatctg
cccttggaactggaaaacctgaggtga

DBGET integrated database retrieval system