KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101151018Help
Entry
101151018         CDS       T02442                                 

Gene name
KAT5
Definition
histone acetyltransferase KAT5 isoform 1
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
HTLV-I infection
Class
Human Diseases; Infectious diseases; HTLV-I infection [PATH:ggo05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 461 aa AA seqDB search
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
ERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVKRKVEVVSPATPVPSETAPASVFPQ
NGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNI
ECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNE
IYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIV
GYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLL
SYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQY
ILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtgggggagataatcgagggctgccgcctacccgtgctgcggcggaaccag
gacaacgaagatgagtggcccctggccgagatcctgagcgtgaaggacatcagtggccgg
aagcttttctacgtccattacattgacttcaacaaacgtctggatgaatgggtgacacac
gagcggctggacctaaagaagatccagttccccaagaaagaggccaagacccccaccaag
aacggacttcctgggtcccgtcccggctctccagagagagaggtgaaacggaaggtggag
gtggtttcaccagcaactccagtgcccagcgagacagccccggcctcggtttttccccag
aatggagcagcccgtagggcagtggcagcccagccaggacggaagcgaaaatcgaattgt
ttgggcactgatgaggactcccaggacagctctgatggaataccgtcagcaccacgcatg
actggcagcctggtgtctgatcgaagccacgacgacatcgtcacccggatgaagaacatt
gagtgcattgagctgggccggcaccgcctcaagccgtggtacttctccccgtacccacag
gaactcaccacattgcctgtcctctacctgtgcgagttctgcctcaagtacggccgtagt
ctcaagtgtcttcagcgtcatttgaccaagtgcgacctacgacatcctccaggcaatgag
atttaccgcaagggtaccatctccttctttgagattgatggacgtaagaacaagagttat
tcccagaacctgtgtcttttggccaagtgtttccttgaccataagacactgtactatgac
acagaccctttcctcttctacgtcatgacggagtatgactgtaagggcttccacatcgtg
ggttacttctccaaggagaaagaatcgacggaggactacaatgtggcctgcatcctaacc
ctgcctccctaccagcgccggggctacggcaagctgctgatcgagttcagctatgaactc
tccaaagtggaagggaaaacagggacccctgagaagcccctctcagaccttggcctccta
tcctatcgaagctactggtcccagaccatcctggagatcctgatggggctgaagtcggag
agcggggagaggccacagatcaccatcaatgagattagtgaaatcaccagcatcaagaag
gaggatgtcatctccactctgcagtacctcaatctcatcaactactacaagggccagtat
atcctcacactgtcggaggacatcgtggatggccatgagcgggccatgctcaagcggctc
ctgcggatcgactccaagtgtctgcacttcactcccaaggactggagcaagagggggaag
tggtga

DBGET integrated database retrieval system