KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101151252Help
Entry
101151252         CDS       T02442                                 

Gene name
SUV420H1
Definition
histone-lysine N-methyltransferase SUV420H1
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101151252 (SUV420H1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101151252 (SUV420H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 860 aa AA seqDB search
MKWLGESKNMVVNGRRNGGKLSNDHQQNQSKLQHTGKDTLKAGKNAVERRSNRCHGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFS
HNNPVRSRRNEELLCDSSLSVYKLDLQLNFLQRGKCVFIYLRMFATDSGFEILPCNRYSS
EQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWL
GPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCE
RRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNTDADTT
QEKNNATSNRKSSVGVKKNSKSRTLTRQSMSRIPASSNSTSSKLTHINNSRVPKKLKKPA
KPLLSKIKLRNHCKRLEQKNASRKLEMGNLVLKEPKVVLYKNLPIKKDKEPEGPAQAAVA
SGCLTRHAAREHRQNPVRGAHSQGESSPCTYITRRSVRTRTNLKEASDIKLEPNTLDGYK
SSVTEPCPDSGEQPQPAPVLQEEELAHETAQKGEAKCHKSDTGMSKKKSRQGKLVKQFAK
IEESTPVHDSPGKDDAVPDLMGPHSDQGEHSGTVGVPVSYTDCAPSPVGCSVVTSDSFKT
KDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLRRRHDSSSKTNDQENDGMNSSKISI
KLSKDHDNDNNLYVAKLNNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDP
LSLLESRMEVDDYSQYEEESTDDSSSSEGDEEEDDYDDDFEDDFIPLPPAKRLRLIVGKD
SIDIDISSRRREDQSLRLNA
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaatccaagaacatggtggtgaatggcaggagaaatggaggcaag
ttgtctaatgaccatcagcagaatcaatcaaaattacagcacacggggaaggacaccctg
aaggctggcaaaaatgcagtcgagaggaggtcgaacagatgtcatggtaactcgggattt
gaaggacagagtcgctatgtaccatcctctggaatgtccgccaaggaactctgtgaaaat
gatgacctagcaaccagtttggttcttgatccctatttaggttttcaaacacacaaaatg
aatactagcgcctttccttcgaggagctcaaggcatttttcaaaatctgacagtttttct
cacaacaaccctgtgaggtcaagaaggaatgaagagctgctctgcgactcctcactcagc
gtctacaaactggatttgcagctaaactttcttcagagggggaaatgtgtatttatttat
ttgcgaatgtttgcaactgacagtggatttgaaatattgccatgtaatagatactcatca
gaacaaaatggagccaaaatagttgcaacaaaagaatggaaacgaaatgacaaaatagaa
ttactggtgggttgtattgccgaactttcagaaattgaggagaacatgctacttagacat
ggagaaaacgacttcagtgtcatgtactccacaaggaaaaactgtgctcaactctggctg
ggtcctgctgcgtttataaaccatgattgcagacctaattgtaagtttgtgtcaactggt
cgagatacagcatgtgtgaaggctctaagagacattgaacctggagaagaaatttcttgt
tattatggagatgggttctttggagaaaataatgagttctgcgagtgttacacttgcgaa
agacggggcactggtgcttttaaatccagagtgggactgcctgcgcctgctcctgttatc
aatagcaaatatggactcagagaaacagataaacgtttaaataggcttaaaaagttaggt
gacagcagcaaaaattcagacagtcaatctgtcagctctaacactgatgcagataccact
caggaaaaaaacaatgcaacttctaaccgaaaatcttcagttggcgtaaaaaagaatagc
aagagcagaacgttaacgaggcaatctatgtcaagaattccagcttcttccaactctacc
tcatctaagctaactcatataaataattccagggtaccaaagaaactgaagaagcctgca
aagcctttactttcaaagataaaattgagaaatcattgcaagcggctggagcaaaagaat
gcttcaagaaaactcgaaatgggaaacttagtactgaaagagcctaaagtagttctctat
aaaaatttgcccattaaaaaagataaggagccagagggaccagcccaagccgcagttgcc
agcgggtgcttgactagacacgcggcgagagaacacagacagaatcctgtgagaggtgct
cattcgcagggggagagctcgccctgcacctacataactcggcggtcagtgaggacaaga
acaaatctgaaggaggcctctgacatcaagcttgaaccaaatacgttggatggctataaa
agcagtgtgacggaaccttgccccgacagtggtgaacagccgcagccagctcccgtgctg
caggaggaagaactggctcatgagactgcacaaaaaggggaggcaaagtgtcataagagt
gacacaggcatgtccaaaaagaagtcacgacaaggaaaactagtgaaacagtttgcaaaa
atagaggaatctactccagtgcacgattctcctggaaaagatgacgcggtaccagatttg
atgggtccccattctgaccagggtgagcacagtggcactgtgggcgtgcctgtgagctac
acagactgtgctccttcacccgtcggttgttcagttgtgacatcagatagcttcaaaaca
aaagacagctttagaactgcaaaaagtaaaaagaagaggcgaatcacaaggtatgacgca
cagttaatcctagaaaataactctgggattcccaaattgactcttcgtaggcgtcatgat
agcagcagcaaaacaaatgaccaagagaatgatggaatgaactcttccaaaataagcatc
aagttaagcaaagaccatgacaacgataacaatctctatgtagcaaagcttaataatgga
tttaactcaggatcaggcagtagttctacaaaattaaaaatccagctaaaacgagatgag
gaaaatagggggtcttatacagaggggcttcatgaaaatggggtgtgctgcagtgatcct
ctttctctcttggagtctcgaatggaggtggatgactatagtcagtatgaggaagaaagt
acagatgattcctcctcttctgagggcgatgaagaggaggatgactatgatgatgacttt
gaagacgattttattcctcttcctccagctaagcgcttgaggttaatagttggaaaagac
tctatagatattgacatttcttcaaggagaagagaagatcagtctttaaggcttaatgcc
taa

DBGET integrated database retrieval system