KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101151695Help
Entry
101151695         CDS       T02442                                 

Gene name
GSTK1
Definition
glutathione S-transferase kappa 1 isoform 1
Orthology
K13299  
glutathione S-transferase kappa 1 [EC:2.5.1.18]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Peroxisome
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101151695 (GSTK1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101151695 (GSTK1)
   00982 Drug metabolism - cytochrome P450
    101151695 (GSTK1)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    101151695 (GSTK1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    101151695 (GSTK1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101151695 (GSTK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 226 aa AA seqDB search
MGSLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLIAGIMKDSGNKPPGLLP
RKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLGKGSLSAMRFLTAVNLEHPEMLEKASRE
LWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGA
FGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPVPPAVNARL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggggtccctgccgcgcaccgtggagctcttctatgacgtgctgtccccctactcctgg
ctgggcttcgagatcctgtgccggtatcagaatatctggaacatcaacctgcagttgcgg
cccagcctcatagcagggatcatgaaagacagtggaaacaagcctccaggtctgcttccc
cgcaaaggactatacatggcaaatgacttaaagctcctgagacaccatctccagattccc
atccacttccccaaggatttcttgtctgtgatgcttggaaaaggaagtttgtctgccatg
cgtttcctcaccgccgtgaacttggagcatccagagatgctggagaaagcgtcccgggag
ctgtggatgcgcgtctggtcaaggaatgaagacatcaccgagccgcagagcatcctggcg
gctgcagagaaggctggtatgtctgcagaacaagcccagggacttctggaaaagatcgca
acgccaaaggtgaagaaccagctcaaggagaccactgaggcagcttgcagatacggggcc
tttgggctgcccatcaccgtggcccatgtggatggccaaacccacatgttatttggctct
gaccggatggagctgctggcgcacctgctgggagagaagtggatgggccctgtacctcca
gccgtgaatgccagactttaa

DBGET integrated database retrieval system