KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101151843Help
Entry
101151843         CDS       T02442                                 

Gene name
EHMT1
Definition
histone-lysine N-methyltransferase EHMT1
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101151843 (EHMT1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101151843 (EHMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 1267 aa AA seqDB search
MAADEGSAEKQAGEAHMAADGETNGSCENSDASSHANAAKHTQDSARVHPQDGTNTLTRI
AENGVSERDSEAGKQNHVTADDFVQTSVIGSNGYILNKPALQAQPLRTTSTLASSLPGHA
AKTLPGGAGKGRTPSAFPQTPAAPPATLGEGSADTEDRKLPAPGADVKVHRARKTMPKSV
VGLHAASKDPREVREARDHKEPKEEINKNISDFGRQQLLPPFPSLHQSLPQNQCYMATTK
SQTACLPFVLAAAVSRKKKRRMGTYSLVPKKKTKVLKQRTVIEMFKSITHSTVGSKGEKD
LGASSLHVNGESLEMDSDEDDSEELEEDDGHGAEQAAAFPTEDSRTSKESMSEADRAQKM
DGESEEEQESVDTGEEEEGGDESDLSSESSIKKKFLKRKGKTDSPWIKPARKRRRRSRKK
PSGALGSESYKSSAGSAEQTAPGDSTGYMEVSLDSLDLRVKGILSSQAEGLANGPDVLET
DGLQEVPLCSCRMETPKSREITTLANNQCMATESVDHELGRCTNSVVKYELMRPSNKAPL
LVLCEDHRGRMVKHQCCPGCGYFCTAGNFMECQPESSISHRFHKDCASRVNNASYCPHCG
EESSKAKEVTIAKADTTSTVTPVPGQEKGSALEGRADTTTGSAAGPPLSEDDKLQGTASH
VPEGFDPTGPAGLGRPTPGLSQGPGKETLESALIALDSEKPKKLRFHPKQLYFSARQGEL
QKVLLMLVDGIDPNFKMEHQNKRSPLHAAAEAGHVDICHMLVQAGANIDTCSEDQRTPLM
EAAENNHLEAVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYEVVQYLLSNGQMDVNCQDD
GGWTPMIWATEYKHVDLVKLLLSKGSDINIRDNEENICLHWAAFSGCVDIAEILLAAKCD
LHAVNIHGDSPLHIAARENRYDCVVLFLSRDSDVTLKNKEGETPLQCASLNSQVWSALQM
SKALQDSAPDRPSPVERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMN
IDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSC
WRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPLGTFVCEYVGELISDSEADVREED
SYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRL
IEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHSSAALAQRQASAAQEAQEDGLPDTSS
AAAADPL
NT seq 3804 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgatgaaggctcagcagagaaacaggcaggagaggcccacatggctgcggac
ggtgagaccaatgggtcttgtgaaaacagcgacgccagcagtcatgcaaatgctgcaaag
cacactcaggacagcgcaagggtccacccccaggatggcaccaacacactaacccggata
gcggaaaacggggtttcagaaagagactcagaagcggggaagcaaaaccacgtcactgcc
gacgactttgtgcagacttctgtcatcggcagcaacggatacatcttaaataagccggcc
ctacaggcacagcccttgaggactaccagcactctggcctcttcgctgcctggccatgct
gcaaaaacccttcctggaggggctggcaaaggcaggactccaagcgcttttccccagacg
ccagccgccccaccagccacccttggggaggggagtgctgacacagaggacaggaagctc
ccggcccctggcgccgacgtcaaggtccacagggcacgcaagaccatgccgaagtccgtc
gtgggcctgcatgcagccagtaaagatcccagagaagttcgagaagctagagatcataag
gaaccaaaagaggagatcaacaaaaacatttctgactttggacgacagcagcttttaccc
cccttcccatcccttcatcagtcgctacctcagaaccagtgctacatggccaccacaaaa
tcacagacagcttgcttgccttttgttttagcagctgcagtatctcggaagaaaaaacga
agaatgggaacctatagcctggttcctaagaaaaagaccaaagtattaaaacagaggacg
gtgattgagatgtttaagagcataactcattccactgtgggttccaagggggagaaggac
ctgggcgccagcagcctgcacgtgaatggggagagcctggagatggactcggatgaggac
gactcagaggagctcgaggaggacgacggccatggcgcagagcaggcggccgcgttcccc
acagaggacagcaggacttccaaggagagcatgtcggaggctgatcgcgcccagaagatg
gacggggagtccgaggaggagcaggagtccgtggacaccggggaggaggaggaaggcggt
gacgagtccgacctgagttcggaatccagcatcaagaagaaatttctcaagaggaaagga
aagaccgacagtccctggatcaagccagccaggaaaaggaggcggagaagtagaaagaag
cccagcggtgccctcggttctgagtcgtataagtcatctgcaggaagcgctgagcagacg
gcaccaggagacagcacagggtacatggaagtttctctggactccctggatctccgagtc
aaaggaattctgtcttcacaagcagaagggttggccaacggtccagatgtgctggagaca
gacggcctccaggaagtgcctctctgcagctgccggatggaaacaccgaagagtcgagag
atcaccacgctggccaacaaccagtgcatggctacagagagcgtggaccatgaattgggc
cggtgcacaaacagcgtggtcaagtatgagctgatgcgcccctccaacaaggccccgctc
ctcgtgctgtgtgaagaccaccggggccgcatggtgaagcaccagtgctgtcctggctgt
ggctacttctgcacagcgggtaattttatggagtgtcagcccgagagcagcatctctcac
cgtttccacaaagactgtgcctctcgagtcaataacgccagctattgtccccactgtggg
gaggagagctccaaggccaaagaggtgacgatagctaaagcagacaccacctcgaccgtg
acaccagtccccgggcaggagaagggctcggccctggagggcagggccgacaccacaacg
ggcagtgctgcagggccaccactctcggaggatgacaagctgcagggtacagcctcccac
gtgcccgagggctttgatccaacgggacctgctgggcttgggaggccaactcccggcctt
tcccagggaccagggaaggaaaccttggagagcgctctcatcgcccttgactcggaaaaa
cccaagaagcttcgcttccacccaaagcagctgtacttctccgccaggcaaggggagctt
cagaaggtgctcctcatgctggtggacggaattgaccccaacttcaaaatggagcaccag
aataagcgctctccactgcacgccgcggcagaggctggacacgtggacatctgccacatg
ctggttcaggcgggcgctaatattgacacctgctcagaagaccagaggaccccgttgatg
gaagcagccgaaaacaaccatctggaagcagtgaagtacctcatcaaggccggggccctg
gtggatcccaaggacgcagagggctctacgtgtttgcacctggctgccaagaaaggccac
tacgaagtggtccagtacctgctttcaaatggacagatggacgtcaactgtcaggatgac
ggaggctggacacccatgatctgggccacggagtacaagcacgtggacctcgtgaagctg
ctgctgtccaagggctctgacatcaacatccgggacaacgaggagaacatttgcctgcac
tgggcggcgttctccggttgcgtggacatagccgagatcctgctggctgccaagtgcgac
ctccacgccgtgaacatccacggagactcgccactgcacattgccgcccgggagaaccgc
tacgactgtgtcgtcctctttctttctcgggattcagatgtcaccttaaagaacaaggaa
ggagagacgcccctgcagtgtgcgagcctcaactctcaggtgtggagcgctctgcagatg
agcaaggctctgcaggactcggcccccgacaggcccagccccgtggagaggatagtgagc
agggacatcgctcgaggctacgagcgcatccccatcccctgtgtcaacgccgtggacagc
gagccttgccccagcaactacaagtacgtctctcagaactgcgtgacgtcccccatgaac
atcgacagaaatatcactcatctgcagtactgcgtgtgcatcgacgactgctcctccagc
aactgcatgtgcggccagctcagcatgcgctgctggtacgacaaggacggccggctcctg
ccagagttcaacatggcggagcctcccttgatcttcgaatgcaaccacgcgtgctcctgc
tggaggaactgccgaaatcgcgtcgtacagaatggtctcagggcaaggctgcagctctac
cggacgcgagacatgggctggggcgtgcggtccctgcaggacatcccactaggcaccttt
gtctgcgagtatgttggggagctgatttcagactcagaagccgatgttcgagaggaagat
tcttacctctttgatctcgacaataaggacggggaggtttactgcatcgacgcgcggttc
tacgggaacgtcagccggttcatcaaccaccactgcgagcccaacctggtgcccgtgcgc
gtgttcatggcccaccaggacctgcggttcccccggatcgccttcttcagcacccgcctg
atcgaggccggcgagcagctcgggtttgactatggagagcgcttctgggacatcaaaggc
aagctcttcagctgccgctgcggctcccccaagtgccggcactcgagcgcggccctggcc
cagcgtcaggccagcgcggcccaggaggcccaggaggacggcttgcccgacaccagctcc
gcggctgccgccgacccgctatga

DBGET integrated database retrieval system