KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101151875Help
Entry
101151875         CDS       T02442                                 

Gene name
PLCZ1
Definition
(RefSeq) phospholipase C zeta 1
  KO
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101151875 (PLCZ1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101151875 (PLCZ1)
   04070 Phosphatidylinositol signaling system
    101151875 (PLCZ1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    101151875 (PLCZ1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101151875 (PLCZ1)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101151875 (PLCZ1)
Membrane trafficking [BR:ggo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101151875 (PLCZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
ENSGGOG00000004982
Position
12
AA seq 642 aa AA seqDB search
MEMRWFLSKIQDDFRGGKINLEKTQRLLEKLDIRCSYIHVKQIFKDNDRLKQGRITIEEF
RAIYRIITHREEIIEIFNTYSENRKILLESNLAQFLTQEQYAAEMSKAIAFEIIQKYEPI
EEVRKAHQMSLEGFTRYMDSRECLLFKNECRKVYQDMTHPLNDYFISSSHNTYLVSDQLV
GPSDLWGYVSALVKGCRCLEIDCWDGAQNEPVVYHGYTLTSKLLFKTVIQAIHKYAFMTS
DYPVVLSLENHCSTAQQEVMADNLQATFGESLLSDMLDDFPDTLPSPEALKFKILVKNKK
IGTLKETRERKGSDKRGKVEEWEEEVADVDEEEEEEEDTFKESEVLESVLGDNQDKETGV
KKLPGVMLFKKKKTRKLKIALALSDLVIYTKAEKFKSFQHSRLYQQFNENNSIGETQARK
LSKLRVHEFIFHTRKFITRIYPKATRADSSNFNPQEFWNIGCQMVALNFQTPGLPMDLQN
GKFLDNGGSGYILKPHFLRESKSYFNPSNIKEGMPITLTIRLISGIQLPLTHSSSNKGDS
LVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETFTFIIHVPELALIRFVVESQGLIAGNE
FLGQYTLPLLCMNKGYRRVPLFSRMGESLEPASLFVYVWYVR
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgagatggtttttatcaaagattcaggatgacttcagaggtggaaaaattaac
ctagaaaaaactcagaggttacttgaaaaattagatattcggtgcagttatattcatgtg
aaacagatttttaaggacaatgacaggctgaaacaaggaagaatcaccatagaagaattt
agagcaatttatcgaattatcacgcacagagaagaaattattgagattttcaacacatat
tctgaaaaccggaaaattcttttagaaagtaatctggctcaatttctgacacaagaacaa
tatgcagctgagatgagtaaagctattgcttttgagatcattcagaaatacgagcctatc
gaagaagttaggaaagcacaccaaatgtcattagaaggttttacaagatacatggattca
cgtgaatgtctactgtttaaaaatgaatgtagaaaagtttatcaagatatgactcatcca
ttaaatgattattttatttcatcttcacataacacgtatttggtatctgatcaattagtg
ggaccaagtgacctttggggatatgtaagtgcccttgtgaaaggatgccgttgtttggag
attgactgctgggatggagcacaaaatgaacctgttgtatatcatggctacacactcaca
agcaaacttctgtttaaaactgttatccaagctatacacaagtatgcattcatgacatct
gactacccagtggtgctctctttagaaaatcactgctccactgcccaacaagaagtaatg
gcagacaatttgcaggctacttttggagagtccttgctttctgatatgcttgatgatttt
cctgatactctaccatcaccagaggcactaaaattcaaaatattagttaaaaataagaaa
ataggaaccttaaaggaaacccgtgaaagaaaaggttctgataagcgtggtaaggtggag
gaatgggaagaagaagtggcagatgtagacgaggaggaggaggaggaggaggatacattc
aaagaatcagaagtattggaatctgttttaggagacaatcaagacaaggaaacaggggta
aaaaagttacctggagtaatgcttttcaagaaaaagaagaccaggaagctaaaaattgct
ctggccttatctgatcttgtcatttatacgaaagctgagaagttcaaaagctttcaacat
tcaagattatatcagcaatttaatgaaaataattctattggggagacacaagctcgaaaa
ctttcaaaattgcgagtccatgagtttatttttcacaccaggaagttcattaccagaata
tatcccaaagcaacaagagcagactcttctaattttaatccccaagaattttggaatata
ggttgtcaaatggtggctttaaatttccagacccctggtttgcctatggatctgcaaaat
gggaaatttttggataatggtggttctggatatattttgaaaccacatttcttaagagag
agtaaatcatactttaacccaagtaacataaaagagggtatgccaattacacttacaata
aggctcatcagtggtatccagttgcctcttactcattcatcatctaacaaaggtgattca
ttagtaattatagaagtttttggtgttcccaatgatcaaatgaagcagcagactcgtgta
attaaaaaaaatgcttttagtccaagatggaatgaaacattcacatttattattcatgtc
ccagaattggcattgatacgttttgttgttgaaagtcaaggtttaatagcaggaaatgaa
tttcttgggcaatatactttgccacttctatgcatgaacaaaggttatcgtcgtgttcct
ctgttttccagaatgggtgagagccttgagcctgcttcactgtttgtttatgtttggtac
gtcagataa

DBGET integrated database retrieval system