KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101152172Help
Entry
101152172         CDS       T02442                                 

Gene name
NUP205
Definition
nuclear pore complex protein Nup205
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
RNA transport
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:ggo03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 2012 aa AA seqDB search
MATPLAVNSAASLWGPYKDIWHKVGNALWRRQPEAVHLLDKILKKHKPDFISLFKNPPKN
VQQHEKVQKASTEGVAIQGQQGTRLLPEQLIKEAFILSDLFDIGELAAVELLLAGEHQQP
HFPGLTRGLVAVLLYWDGKRCIANSLKALIQSRRGKTWTLELSPELASMTTRFTDELMEQ
GLTYKVLTLVSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFAWACQSP
LGKEDTLLLIGHLERVTVEANGSLDAVNLALLMALLYCFDISFIEQSTEERDDMIHQLPL
LTEKQYIATIHSRLQDSQLWKLPGLQATVRLAWALALRGISQLPDVTALAEFTEADEAMA
ELAIADNVFLFLTESVVVSEYFYQEEFYIRRVHNLITDFLALMPMKVKQLRNRADEDARM
IHMSMQMGNEPPISLRRDLEHLMLLIGELYKKNPFHLELALEYWCPTEPLQTPTIMGSYL
GVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCAHYCFSLLKVNGSS
HVENIQGAGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPSRGITQKEQDGLIAF
LQLTSTIITWSENARLALCEHPQWTPVVVILGLLQCSIPPVLKAELLKTLAAFGKSPEIA
ASLWQSLEYTQILQTVRIPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFP
SNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQL
EDFIDQFVELQGEEIIAYKPPGFSLMYHLLNESPMLELALSLLEEGVKQLDTYAPFPGKK
HLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVCPLEQLLQGINPRTKKADNVVNIA
RYLYHGNTNPELAFESAKILCCISCNSNIQIKLVGDFTHDQSISQKLMAGFVECLDCEDA
EEFVRLEEGSELEKKLVAIHHETRIHILNLLITSLECNPPNLALYLLGFELKKPVGTTNL
QDPGVLGCPRTCLHAILNILEKGTEGRTGPVAVRESPQLAELCYQVIYQLCACSDTSGPT
MRYLRTSQDFLFSQLQYLPFSNKEYEMSMLNQMSWLMKTASIELRVTSLNRQRSHTQRLL
HLLLDDMPVKPYSDGEGGIEDENRSVSGFLHFDTATKVRRKILSILDSIDFSQEIPEPLQ
LDFFDRAQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEIS
TVLQYVVGRNKLLQCLHAKRHALESWRQLVEIILTACPQDLIQAEDRQLIIRDILQDVHD
KILDDEAAQELMPVVAGAVFTLTAHLSQAVLTEQKQTSVLGPAEAHYAFMLDSCFTSPPP
EENSLVGFASIGDSSLYIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDT
LEAAKKTMWERLTAPEDVFSKLQRENIAIIESYGAALMEVVCRDACDGHEIGRMLALALL
DRIVSVDKQQQWLLYLSNSGYLKVLVDSLVEDDRTLQSLLTPQPPLLKALYTYESKMAFL
TRVAKIQQGALELLRSGVIVRLAQCQVYDMRPETDPQSMFGMRDPPMFIPTPVDRYRQIL
LPALQLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQAILRCQDVSAGSLQELALLTGII
SKAALPGILSELDVDVNEGSLMELQGHIGRFQRQCLGLLSRFGGSDRLRQFKFQDDNVEG
DKVSKKDEIELAMQQICANVMEYCQSLMLQSSPTFQHAVCLFTPSLSETVNRDGPRQDTQ
APVVPYWRLPGLGIIIYLLKQSANDFFSYYDSHRQSVSKLQNVEQLPPDEIKELCQSVMP
AGVDKISTAQKYVLARRRLVKVINNRAKLLSLCSFIIETCLFILWRHLEYYLLHCMPTDS
QDSLFASRTLFKSRRLQDSFASETNLDFRSGLAIVSQHDLDQLQADAINAFGESLQKKLL
DIEGLYSKVRSRYSFIQALVRRIRGLLRISRN
NT seq 6039 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcctttggcggtaaattcggctgctagtctatggggtccttacaaagacatt
tggcataaagtgggaaatgctctttggagaagacaacctgaagctgttcaccttctcgat
aagattttgaagaaacacaaacctgacttcatctcattgttcaaaaatccgccaaaaaat
gttcaacagcatgagaaggttcagaaagccagtacagagggagtcgccattcagggtcaa
cagggaactcgacttcttcctgaacagctcattaaagaagcctttattctcagtgacctt
tttgatattggagaattggcagctgttgagcttcttcttgctggagagcatcaacagcca
cattttcctggccttaccagaggattagtagctgttcttttgtactgggatggaaagcga
tgcattgcgaattccttgaaagccttgatacagtctagacggggaaagacatggacccta
gaactcagtccagagctggcttccatgacaacacgctttacagatgagctgatggagcaa
ggattgacttataaagttcttaccctggtgtcacagattgatgtgaataatgagtttgag
aaactacagcgagagagaggtttgggcagtgaaaaacatcgcaaagaggtttctgatctc
attaaggagtgcaggcagtctcttgcagaaagcctttttgcctgggcttgccagtcacct
ttaggcaaagaagacactctcctcctcattggacatttggaaagagtgacagttgaggct
aatggctcactggatgcagtgaatctggctcttcttatggcgcttctatactgttttgac
atcagttttatagagcaaagcacagaggaacgagatgatatgattcatcaacttccactg
ttgacagaaaaacagtacattgcaacaattcactctcgtcttcaggactcacagctttgg
aaactgcctgggctccaagccactgttagacttgcctgggcgctggcattgaggggaata
tcacagctacctgatgtgacagctctggcagaattcacagaggcagatgaagcaatggca
gaactcgcaattgctgacaacgttttcctgttcctcacggaatctgtagtggtatcagaa
tacttttatcaggaagaattttatattcgcagagtccataatctcatcacagatttcctt
gcacttatgccaatgaaggtgaaacagctgaggaatcgggcagatgaagatgctcgaatg
attcacatgagtatgcagatgggtaatgaaccccccatttcacttagaagggacctggaa
cacttaatgcttttgattggcgagctatataaaaagaacccttttcatctggagcttgct
ctagaatattggtgtcccacagagcctcttcagactccgactatcatgggctcttatcta
ggggtggctcatcagcggccccctcaacgccaggttgtcttgtcaaagtttgttaggcaa
atgggtgacctgttgcctccaactatttatattccttatttgaagatgctccagggattg
gccaatgggcctcagtgtgcccactactgtttcagcctgctcaaagtcaatggtagtagt
catgttgaaaatattcagggagcaggtggcagtcctgtttcctgggaacatttctttcac
tccttgatgctttaccacgaacaccttcggaaggatcttccaagtgcagatagcgtccag
taccgtcaccttccttcccgtggcatcacccagaaggagcaagatggattgattgctttt
ttgcagctcacgtctaccatcattacttggagtgaaaatgctcgtttggcactctgtgaa
caccctcagtggacccctgttgtggtgattctgggactcctccaatgcagtattccccct
gtcctaaaagctgagctactgaagacactcgcagcttttggaaaatctcctgaaattgct
gcttccctctggcagtcattggaatacactcagatactgcagaccgtgaggattccaagc
caaaggcaagctattggtattgaggttgaactaaatgaaatagaatcccggtgtgaagaa
tacccattgactcgggccttttgccagcttattagtaccctggtggagagctcatttcct
tctaatttgggtgctggactgcggccccctggctttgacccttatttgcagttccttaga
gactctgtgtttctacgattccgtacgagagcttaccggagagcagctgaaaagtgggaa
gttgctgaggtggttttggaggtgttttataaattgctcagagattacgagcctcagctt
gaagattttatagaccagtttgtggaactacaaggagaagaaatcatagcctataagcca
cctggatttagtctgatgtatcatctgctgaatgagtcaccaatgttggagcttgctctc
agtttactggaagaaggagttaagcagcttgacacctatgccccctttcctgggaaaaaa
cacctggagaaagcagtacagcattgccttgcacttctcaatcttactctgcaaaaggaa
aatctttttatggaccttctaagagagagtcaactggctctaatagtctgtcctttagaa
cagcttttgcagggaattaatcccagaactaagaaggcagataatgtggtaaacattgcc
agatacctatatcatggcaatactaatccagaattggcttttgaaagtgccaagatcctc
tgttgtatctcttgcaactctaatattcagataaagttggttggagatttcacacatgac
cagagtataagtcagaaactaatggctggatttgtggagtgtttggattgtgaagatgca
gaagaatttgtacgtctggaagagggatcagaacttgaaaagaaattagttgcaattcat
catgaaacaagaatccacatcttgaatcttctcattacctctctggaatgcaatccaccc
aatcttgctctctacctgttgggctttgaattgaaaaaacctgtcggtactacaaaccta
caagatccaggagtgttaggttgccctcggacatgccttcacgccattctaaacatcttg
gagaaaggaacggaagggagaacaggcccagtggcagtgcgagaatctcctcaactggct
gagttatgttaccaggtcatatatcagttatgtgcatgctctgatacatctggtcctact
atgaggtacttgagaaccagccaggatttcttattttcccagttgcagtatctaccattt
tctaacaaagaatatgaaatgtctatgctgaaccagatgtcatggcttatgaaaactgcc
tcaatagagctaagggtaacctctctgaatcgtcagcggtcgcatacccagaggctccta
cacctcttactggatgacatgccagtgaaaccatactcagatggtgaaggaggaatagaa
gatgaaaacaggtctgtttctgggttccttcactttgacactgctacaaaagtacgtcga
aaaattctaagtattcttgactcgattgacttcagtcaggagatccctgagcctttgcag
ttggatttttttgatcgggcccagattgaacaagttattgctaactgtgaacacaagaat
ttacggggacagacagtctgcaatgtcaagcttcttcatagggttcttgtagctgaagta
aatgcccttcagggtatggcagccataggacagagacctctactaatggaggaaatcagc
actgtacttcagtatgtggtaggaagaaataaattgctgcagtgtcttcatgcaaaacgt
catgctctggagtcgtggaggcaactggtagaaattatactgacagcttgtccccaggac
ctcattcaggcagaggatcgacaactgattattcgtgatattttacaagatgtgcatgat
aagatactggatgatgaagctgcgcaagagttaatgcctgtggtcgccggggcagtgttc
acactgactgctcacctaagccaggccgtcctcactgaacagaagcaaacatcagtcttg
ggaccagcagaggcccattacgcttttatgcttgatagttgcttcacctcacctcctcct
gaagagaactcattagtgggttttgcttctattggagattcttcactttacatcatattg
aagaaactgttagacttcattttgaagacaggtggtggattccaacgagtgaggactcac
ttgtatggctctctgctttattacttacagattgctcagagacctgatgaaccagacacc
ttagaagcagccaagaaaaccatgtgggaaaggctcacagcccctgaagatgtatttagc
aaattacagcgagaaaacatagccattattgaaagttatggcgccgccctcatggaagtg
gtctgtcgagatgcttgtgatggtcatgagattggaaggatgctggccctggctctactt
gatagaattgtctctgtggataaacagcagcagtggcttttgtatctttctaacagtggc
tacttgaaggtcctcgtagacagcttggtagaagatgaccgtactttgcagagcttactc
acgccacagcctccccttttaaaagcactttatacttatgaatctaaaatggcatttctc
acaagagtggcaaagatacagcagggggcattagagctgctaagatcaggggtgattgtg
agactagctcaatgccaagtctatgacatgcgcccagaaacggacccgcagagcatgttt
ggcatgagagaccctccaatgttcatccctaccccagtggatcgctaccgccagattctc
ctcccagctctccagctgtgccaggtcatcctcacatctagtatggcccagcacttgcag
gcagcagggcaggtattgcagtttcttatttcacattctgataccatacaagcaattctg
cgctgtcaggatgttagtgctgggtctttgcaggaattggctctgctgacaggaattata
agtaaagcagcacttcctgggatattaagtgaacttgacgttgatgtaaatgaagggtct
ctaatggagctacagggacatattggaagattccagcgccagtgcttaggactactaagt
cgctttggtggctctgacagactgcgtcagtttaaatttcaagacgataatgtggaggga
gataaagtaagcaagaaagatgagattgaactggctatgcagcagatttgtgccaatgta
atggaatattgccagtcactcatgttacagagttcccctaccttccagcatgctgtgtgt
ctcttcactcctagcctttcagaaacagttaatagagatggaccgcggcaagatacccaa
gctccagtggttccatactggcgcctgcctggtttaggcattatcatctacctgctgaaa
cagagtgctaatgatttcttcagctattatgacagtcatcgacagagcgtcagcaagcta
caaaatgtagagcagcttcccccagatgagataaaagagttatgtcagtctgtgatgcct
gctggtgttgataaaatctccactgcccagaaatatgttctagcaagacggcgcttggtg
aaggtgatcaacaatcgagctaaactgctttccctttgttcttttatcatagagacctgc
ctatttattctttggcgccatctggagtactacttgttacattgcatgcccacggattct
caagattccttatttgcctcgagaaccttgtttaaaagcagaagactgcaagattccttc
gcctcagaaaccaatctagattttagaagtgggctggctatagtgagccaacatgattta
gaccagcttcaggctgatgcaatcaacgcttttggagaatcactacaaaagaaacttctg
gacattgaaggattatattcaaaagttcgatctcgatatagtttcatacaggctcttgtc
agacgtatccgtggcctcttgaggatatcaaggaactga

DBGET integrated database retrieval system