KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101152640Help
Entry
101152640         CDS       T02442                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04010  MAPK signaling pathway
ggo04015  Rap1 signaling pathway
ggo04068  FoxO signaling pathway
ggo04071  Sphingolipid signaling pathway
ggo04218  Cellular senescence
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04370  VEGF signaling pathway
ggo04380  Osteoclast differentiation
ggo04550  Signaling pathways regulating pluripotency of stem cells
ggo04611  Platelet activation
ggo04620  Toll-like receptor signaling pathway
ggo04621  NOD-like receptor signaling pathway
ggo04622  RIG-I-like receptor signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04657  IL-17 signaling pathway
ggo04658  Th1 and Th2 cell differentiation
ggo04659  Th17 cell differentiation
ggo04660  T cell receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04668  TNF signaling pathway
ggo04670  Leukocyte transendothelial migration
ggo04714  Thermogenesis
ggo04722  Neurotrophin signaling pathway
ggo04723  Retrograde endocannabinoid signaling
ggo04728  Dopaminergic synapse
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04912  GnRH signaling pathway
ggo04914  Progesterone-mediated oocyte maturation
ggo04917  Prolactin signaling pathway
ggo04926  Relaxin signaling pathway
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo05014  Amyotrophic lateral sclerosis (ALS)
ggo05132  Salmonella infection
ggo05133  Pertussis
ggo05140  Leishmaniasis
ggo05142  Chagas disease (American trypanosomiasis)
ggo05145  Toxoplasmosis
ggo05152  Tuberculosis
ggo05160  Hepatitis C
ggo05164  Influenza A
ggo05167  Kaposi's sarcoma-associated herpesvirus infection
ggo05169  Epstein-Barr virus infection
ggo05205  Proteoglycans in cancer
ggo05418  Fluid shear stress and atherosclerosis
Module
ggo_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    101152640 (MAPK14)
   04010 MAPK signaling pathway
    101152640 (MAPK14)
   04370 VEGF signaling pathway
    101152640 (MAPK14)
   04668 TNF signaling pathway
    101152640 (MAPK14)
   04068 FoxO signaling pathway
    101152640 (MAPK14)
   04071 Sphingolipid signaling pathway
    101152640 (MAPK14)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    101152640 (MAPK14)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101152640 (MAPK14)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101152640 (MAPK14)
   04620 Toll-like receptor signaling pathway
    101152640 (MAPK14)
   04621 NOD-like receptor signaling pathway
    101152640 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    101152640 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    101152640 (MAPK14)
   04660 T cell receptor signaling pathway
    101152640 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    101152640 (MAPK14)
   04659 Th17 cell differentiation
    101152640 (MAPK14)
   04657 IL-17 signaling pathway
    101152640 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    101152640 (MAPK14)
   04670 Leukocyte transendothelial migration
    101152640 (MAPK14)
  Endocrine system
   04912 GnRH signaling pathway
    101152640 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    101152640 (MAPK14)
   04917 Prolactin signaling pathway
    101152640 (MAPK14)
   04926 Relaxin signaling pathway
    101152640 (MAPK14)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101152640 (MAPK14)
  Nervous system
   04728 Dopaminergic synapse
    101152640 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    101152640 (MAPK14)
   04722 Neurotrophin signaling pathway
    101152640 (MAPK14)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101152640 (MAPK14)
  Development
   04380 Osteoclast differentiation
    101152640 (MAPK14)
  Environmental adaptation
   04714 Thermogenesis
    101152640 (MAPK14)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    101152640 (MAPK14)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    101152640 (MAPK14)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101152640 (MAPK14)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101152640 (MAPK14)
  Infectious diseases
   05132 Salmonella infection
    101152640 (MAPK14)
   05133 Pertussis
    101152640 (MAPK14)
   05152 Tuberculosis
    101152640 (MAPK14)
   05164 Influenza A
    101152640 (MAPK14)
   05160 Hepatitis C
    101152640 (MAPK14)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101152640 (MAPK14)
   05169 Epstein-Barr virus infection
    101152640 (MAPK14)
   05145 Toxoplasmosis
    101152640 (MAPK14)
   05140 Leishmaniasis
    101152640 (MAPK14)
   05142 Chagas disease (American trypanosomiasis)
    101152640 (MAPK14)
  Drug resistance
   01522 Endocrine resistance
    101152640 (MAPK14)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101152640 (MAPK14)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101152640 (MAPK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 101152640
NCBI-ProteinID: XP_018884347
Position
6
AA seq 323 aa AA seqDB search
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVLTLVLNFGDKMDVVSEGE
GFERNYIVILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELL
TGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA
NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEW
KSLTYDEVISFVPPPLDQEEMES
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctctggcgcctatggctctgtgtgtgct
gcttttgacacaaaaacggggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgcgaaaagaacctacagagaactgcgattacttaaacatatgaaacat
gaaaatgtgattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gatgttctcaccctcgttctaaattttggtgataaaatggatgtggtctctgagggggaa
ggatttgagagaaattacatagtgattctggattttggactggctcggcacacagatgat
gaaatgacaggctacgtggccactaggtggtatagggctcctgagatcatgctgaactgg
atgcattacaaccagacagttgatatttggtcagtgggatgcataatggccgagctgttg
actggaagaacattgtttcctggtacagaccatattgatcagttgaagctcattttaaga
ctcgttggaaccccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaac
tatattcagtctttgactcagatgccgaagatgaactttgcgaatgtatttattggtgcc
aatcccctggctgtcgacttgctggagaagatgcttgtattggactcagataagagaatt
acagcggcccaagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaa
ccagtggccgatccttatgatcagtcctttgaaagcagggacctccttatagatgagtgg
aaaagcctgacctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagag
atggagtcctga

DBGET integrated database retrieval system