KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101153108Help
Entry
101153108         CDS       T02442                                 

Gene name
KAT8
Definition
histone acetyltransferase KAT8
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 458 aa AA seqDB search
MAAQGAAAAVAAATSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGET
YLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSDKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEI
YRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLS
YRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK
LVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacagggagctgctgcggcggttgcagcggcgacttcaggggtcgcgggggag
ggcgagcccgggcccggggagaatgcggccgctgaggggaccgccccatccccgggccgc
gtctctccgccgaccccggcgcgcggcgagccggaagtcacggtggagatcggagaaacg
tacctgtgccggcgaccggatagcacctggcattctgctgaagtgatccagtctcgagtg
aacgaccaggagggccgagaggaattctatgtacactacgtgggctttaaccggcggctg
gacgagtgggtagacaagaaccggctggcgctgaccaagacagtgaaggatgctgtacag
aagaactcagacaagtacctgagcgagctcgcagagcagcctgagcgcaagatcactcgc
aaccaaaagcgcaagcatgatgagatcaaccatgtacagaagacttatgcagagatggac
cccaccacagcagccttggagaaggagcatgaggcgatcaccaaggtgaagtatgtggac
aagatccacatcgggaactacgaaattgatgcctggtatttctcaccattccccgaagac
tatgggaaacagcccaagctctggctctgcgagtactgcctcaagtacatgaaatatgag
aagagctaccgcttccacttgggtcagtgccagtggcggcagccccccgggaaagagatc
taccgcaagagcaacatctccgtgtacgaagttgatggcaaagaccataagatttactgt
cagaacctgtgtctgctggccaagcttttcctggaccataagacactgtactttgacgtg
gagccgttcgtcttttacatcctgactgaggtggaccggcagggggcccacattgttggc
tacttctccaaggagaaggagtccccggatggaaacaatgtggcctgcatcctgaccttg
cccccctaccaacgccgtggctacgggaagttcctcatcgctttcagttatgagctctcc
aagctggagagcacggtcggctccccggagaagccgctgtctgacctgggcaagctcagc
taccgcagctactggtcctgggtgctgctggagatcctgcgggacttccggggcacactg
tccatcaaggacctcagccagatgaccagtatcacccaaaatgacatcatcagtaccctg
cagtccctcaatatggtcaagtactggaagggccagcacgtgatctgtgtcacacccaag
ctggtggaggagcacctcaaaagtgcccagtataagaaaccacccatcacagtggactcc
gtctgcctcaagtgggcaccccccaagcacaagcaagtcaagctctccaagaagtga

DBGET integrated database retrieval system