KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101153613Help
Entry
101153613         CDS       T02442                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1-like
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Chemokine signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Huntington's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Amoebiasis
Pathways in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101153613
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    101153613
   04310 Wnt signaling pathway
    101153613
   04020 Calcium signaling pathway
    101153613
   04070 Phosphatidylinositol signaling system
    101153613
   04022 cGMP - PKG signaling pathway
    101153613
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    101153613
 Organismal Systems
  Immune system
   04611 Platelet activation
    101153613
   04062 Chemokine signaling pathway
    101153613
  Endocrine system
   04911 Insulin secretion
    101153613
   04912 GnRH signaling pathway
    101153613
   04915 Estrogen signaling pathway
    101153613
   04921 Oxytocin signaling pathway
    101153613
   04918 Thyroid hormone synthesis
    101153613
   04919 Thyroid hormone signaling pathway
    101153613
   04916 Melanogenesis
    101153613
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101153613
   04270 Vascular smooth muscle contraction
    101153613
  Digestive system
   04970 Salivary secretion
    101153613
   04971 Gastric acid secretion
    101153613
   04972 Pancreatic secretion
    101153613
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101153613
  Nervous system
   04724 Glutamatergic synapse
    101153613
   04725 Cholinergic synapse
    101153613
   04728 Dopaminergic synapse
    101153613
   04726 Serotonergic synapse
    101153613
   04720 Long-term potentiation
    101153613
   04730 Long-term depression
    101153613
   04723 Retrograde endocannabinoid signaling
    101153613
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101153613
  Environmental adaptation
   04713 Circadian entrainment
    101153613
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101153613
  Neurodegenerative diseases
   05010 Alzheimer's disease
    101153613
   05016 Huntington's disease
    101153613
  Infectious diseases
   05146 Amoebiasis
    101153613
   05142 Chagas disease (American trypanosomiasis)
    101153613
   05143 African trypanosomiasis
    101153613
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101153613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 982 aa AA seqDB search
MGSGCLGIPAATFWSTFWERSHRASLFRTSGLSAVSPRLEDKEASCFEFKLQLYMTDLGY
RITNLDIISWRLNQVSAYLMTTMTGVGQVTSTQKIKGQISVDGFMRYLSGEENGVVSPEK
LDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCVELDCWKGRTAE
EEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQQAKMAEYCRLI
FGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKKKLSEQASNTYS
DSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVNYIQPVK
FESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMP
QLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDKHFDPFTEGIVD
GIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQGNAVNPVWEEEP
IVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNERNQPLTLPAVFV
YIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKKEADPGETPSEA
PSEARTTPAENGVNHTTTLTPKPPSQALHSQPAPGSVKAPAKTEDLIQSVLTEVEAQTIE
ELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYLRRRAALEKSAK
KDSKKKSEPSSPDHGSSAIEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQK
REHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKITEAKSKDKSQM
EEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSE
TCHEDPSVSPNFTPPNPQALKW
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atgggttctggctgcttgggaataccagcagcaactttctggagcaccttctgggaaagg
agccacagagcttctctcttcaggacatcaggcttgtctgcggtttctcctagacttgag
gacaaggaagcctcgtgttttgaattcaaattgcaactttacatgacagacttagggtac
agaattacaaatctggacataatttcctggcgattgaatcaagtatcagcatatctgatg
accaccatgacaggagttggacaagtcaccagcactcagaaaatcaaaggacaaatatca
gtggatgggttcatgcgctatctgagtggagaagaaaacggagtcgtttcacctgagaaa
ctggatttgaatgaagacatgtctcagcccctttctcactatttcattaattcctcgcac
aacacctacctcacagctggccaactggctggaaactcctctgttgagatgtatcgccaa
gtgctcctgtctggttgtcgctgtgtggagctggactgctggaagggacggactgcagaa
gaggaacctgtcatcacccatggcttcaccatgacaactgaaatatccttcaaggaagtg
atagaagcaattgcggagtgtgcatttaagacttcaccttttccaattctcctttcgttt
gagaaccatgtggattccccaaagcagcaagccaagatggcggagtactgccgactgatc
tttggggatgcccttctcatggagcccctggaaaaatatccactggaatctggagttcct
cttccaagccctatggatttaatgtataaaattttggtgaaaaataagaagaaatcacac
aagtcatcagaaggaagcggcaaaaagaagctctcagaacaagcctccaacacctacagt
gactcctccagcatgtttgagccctcatccccaggagccggagaagctgatacggaaagt
gacgacgacgatgatgatgatgactgtaaaaaatcttcaatggatgaggggactgctgga
agtgaggctatggccacagaagaaatgtctaatctggtgaactatattcagccagtcaag
tttgagtcatttgaaatttcaaaaaaaagaaataaaagttttgaaatgtcttccttcgtg
gaaaccaaaggacttgaacaactcaccaagtctccagtggaatttgtagaatataacaaa
atgcagcttagcaggatatatccaaaaggaacacgtgtggattcatccaactatatgcct
cagctcttctggaatgcaggttgtcagatggtggcacttaatttccagacaatggacctg
gctatgcaaataaatatggggatgtatgaatacaacgggaagagtggctacagattgaag
ccagagttcatgaggaggcctgacaagcattttgatccatttactgaaggcatcgtagat
gggatagtggcaaacactttgtctgttaagattatttcaggtcagtttctttctgataag
aaagttgggacttacgtggaagtggatatgtttggtttgcctgtggatacaaggaggaag
gcatttaagaccaaaacatcccaaggaaatgctgtgaatcctgtctgggaagaagaacct
attgtgttcaaaaaggtggttcttcctactctggcctgtttgagaatagcagtttatgaa
gaaggaggtaaattcattggccaccgtatcttgccagtgcaagccattcggccaggctat
cactatatctgtctaaggaatgaaaggaaccagcctctgacgctccctgctgtctttgtc
tacatagaagtgaaagactatgtgccagacacatatgcagatgtcatcgaagctttatca
aacccaatccgatatgtgaacctgatggaacagagagctaagcaattggctgctttgaca
ctggaagatgaagaagaagtaaagaaagaggctgatcctggagaaacaccatcagaggct
ccaagtgaagcgagaacgactccagcagaaaatggggtgaatcacactacaaccctgaca
cccaagccaccctcccaggctctccacagccagccagctccaggttctgtaaaggcacct
gccaaaacagaagatcttattcagagtgtcttaacagaagtggaagcacagaccatcgaa
gaactaaagcaacagaaatcgtttgtgaaacttcaaaagaaacactacaaagaaatgaaa
gacctggttaagagacaccacaagaaaaccactgaccttatcaaagaacacactaccaag
tataatgaaattcagaatgactacttgagaaggagagcagctttggaaaagtccgccaaa
aaggacagtaagaaaaaatcggaacccagcagccctgatcatggttcatcagcgattgag
caagacctcgctgccctggatgctgaaatgacccaaaagttaatagacttgaaggacaaa
caacagcagcagctgcttaatcttcggcaagaacagtattatagtgaaaaataccagaag
cgagaacatattaaactgcttattcaaaagttgacggatgtcgcagaagagtgtcagaac
aatcagttaaagaagctcaaagaaatctgtgagaaagaaaagaaagaattaaagaagaaa
atggataaaaagaggcaggagaagataacagaagctaaatccaaagacaaaagtcagatg
gaagaggagaagacagagatgatccggtcatatatccaggaagtggtgcagtatatcaag
aggctagaagaagcgcaaagtaaacggcaagaaaaactcgtagagaaacacaaagaaata
cgtcagcagatcctggatgaaaagcccaagggggaaggttcctcctcattcttgtcggaa
acttgccatgaggatccctctgtttcccccaactttactccccccaaccctcaagctctc
aagtggtga

DBGET integrated database retrieval system