KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101153661Help
Entry
101153661         CDS       T02442                                 

Gene name
ART1
Definition
GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101153661 (ART1)
Cellular antigens [BR:ggo04090]
 Proteins
  101153661 (ART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 327 aa AA seqDB search
MQMPAMMSLLLVSVGLMEALQAQSHPITRRDLFSQEIQLDMALASFDDQYAGCAAAMTAA
LPDLNHTEFQANQVYADSWTLASSQWQERQARWPEWSLSPTRPSPPPLGFRDEHGVALLA
YTANSPLHKEFNAAVREAGRSRAHYLHRFSFKTLHFLLTEALQLLGSGQRPPRCHQVFRG
VHGLRFRPAGPRATVRLGGFASASLKNVAAQQFGEDTFFGIWTCLGAPIKGYSFFPGEEE
VLIPPFETFQVINASRPAQGPARIYLRALGKHSTYNCEYIKDKKCKSGPCHLDNSAMGQS
PLSAVWSLLLLLWFLVVRAFPGGPGLL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgcctgctatgatgtctctgcttcttgtgtctgtgggcctcatggaagcactt
caggcccagagccaccccatcacacgacgagacctcttctctcaagagattcagctggac
atggccctagcctcctttgacgaccagtacgctggctgtgctgctgccatgacagctgct
ctcccggatctcaaccacacggagttccaggccaaccaggtgtatgcggacagctggaca
ctggcgagcagccaatggcaggagcgccaggccaggtggccggagtggagtctcagcccc
actcgtccatccccgccacccctgggcttccgcgatgagcatggggtggccctcctggcc
tacacggccaacagccccctgcacaaggagttcaatgcagccgtgcgtgaggcaggccgc
tcccgggcccactacctccaccgcttctccttcaagacactccatttcctgctgactgag
gccctgcagctcctgggcagcggccagcggccaccccggtgccaccaggtgttccgaggt
gtgcacggcctgcgcttccggccagcagggccccgggccaccgtgaggctggggggcttt
gcttctgcctccctgaagaatgttgcagcccagcagttcggtgaggacaccttctttggc
atctggacctgccttggggcccctatcaagggctactccttcttccctggagaggaagag
gtgctgatccccccctttgagaccttccaagtgatcaatgccagcagaccggcccagggc
cccgcccgcatctacctccgagccctgggcaagcacagcacctacaactgcgagtacatc
aaagacaagaagtgcaagtctgggccttgccatctggataattcagccatgggtcagagc
cccctctctgcagtctggtctttgctgctgctgctctggttcctcgtggtgagggccttt
ccaggcggtccaggcctcctttga

DBGET integrated database retrieval system