KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101154486Help
Entry
101154486         CDS       T02442                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    101154486 (DBH)
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     101154486 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 617 aa AA seqDB search
MPALSRWASLPGPSVREAAFMYSTAVAVFLVILVAALQGSAPRDSPLPYHIPLDPEGSLE
LSWNVSYTQEAIHFQLLVRRLKAGVLFGMSDRGELENADLVVLWTDGDTAYFADAWSDQK
GQIHLDPQQDYQLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSL
EAINGSGLQTGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKG
FSRHHIIKYEPIVTKGNEALVHHMEVFQCAPEMDNVPHFSGPCDSKMKPDRLNYCRHVLA
AWALGAKAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPLVIEGRNDSSGIRLYYTAKLRHF
NAGIMELGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKV
VTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRELATVGG
FGILEEMCVNYVHYYPQTQLELCKSAVDAGFLQKYFHLINRFNNEDVCTCPQASVSQQFT
SVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLKEPTPQCPTSQ
GRSPAGPTVVSIGGGKG
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccctcagtcgctgggccagcctgcccggccccagcgtgcgggaggcagccttc
atgtacagcacagcagtggccgtcttcctggtcatcctggtggccgcactgcagggctcg
gctccccgtgacagccccctcccctatcacatccccctggacccggaggggtccctggag
ctctcatggaatgtcagctacacccaggaggccatccacttccagctcctggtgcggagg
ctcaaggctggcgtcctgtttgggatgtccgaccgtggcgagcttgagaacgcagacctc
gtggtgctctggaccgatggggacactgcctattttgcggatgcctggagtgaccagaag
gggcagatccacctggatccccagcaggactaccagctgctgcaggtgcagaggacccca
gaaggcctgaccctgcttttcaagaggccctttggcacctgcgaccccaaggattacctc
attgaggacggcactgtccacttggtctatgggatcctggaggagccgttccggtcactg
gaggctatcaatggctcgggcctgcagacggggctgcagagggtgcagctcctgaagccc
aatatccccgaaccggagttgccctcagacgcgtgcaccatggaggtccaagctcccaat
atccagatccccagccaggagaccacgtactggtgctacattaaggagcttccaaagggc
ttctctcggcaccacattatcaagtacgagcccatcgtcaccaagggcaacgaggccctc
gtccaccacatggaagtcttccagtgcgcccccgagatggacaacgtcccccacttcagc
gggccctgcgactccaagatgaaacccgaccgcctcaactactgccgccacgtgctggcc
gcctgggccctgggcgccaaggcattttactacccagaggaagccggccttgccttcggg
ggtcctgggtcctccagatatctccgcctggaagttcactaccacaacccactggtgata
gaaggacgaaacgactcctcaggcatccgcttgtactacacagccaagctgcggcacttc
aacgcggggatcatggagctgggactggtgtacacgccagtgatggccattccaccacgg
gagaccgccttcatcctcactggctactgcacggacaagtgcacccagctggcactgcct
ccctccgggatccacatcttcgcctctcagctccacacacacctgactgggagaaaggtg
gtcacagtgctggtccgggacggccgggagtgggagatcgtgaaccaggacaatcactac
agccctcacttccaggagatccgcatgttgaagaaggtcgtgtcggtccatccgggagat
gtgctcatcacctcctgcacgtacaacacggaagaccgggagctggccacagtggggggc
tttgggatcctggaggagatgtgtgtcaactacgtgcactactacccccagacgcagctg
gagctctgcaagagcgctgtggacgccggcttcctgcagaagtacttccacctcatcaac
aggttcaacaacgaggacgtctgcacctgccctcaggcgtccgtgtctcagcagttcacc
tctgttccctggaactccttcaaccgcgacgtactgaaggccctgtacagcttcgcgccc
atctccatgcactgtaacaagtcctcagccgtccgcttccagggtgaatggaacctgcag
cccctgcccaaggtcatctccacactgaaagagcccaccccacagtgccccaccagccag
ggccgaagccctgctggccccactgttgtcagcattggtgggggcaaaggctga

DBGET integrated database retrieval system