KEGG   Gossypium hirsutum (upland cotton): 107931280Help
Entry
107931280         CDS       T04793                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00052  Galactose metabolism
ghi00500  Starch and sucrose metabolism
ghi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ghi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    107931280
   00500 Starch and sucrose metabolism
    107931280
Enzymes [BR:ghi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107931280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 107931280
NCBI-ProteinID: XP_016718617
UniProt: A0A1U8LVS1
Position
Unknown
AA seq 702 aa AA seqDB search
MVDTKPLLPASNSDGSYLTGSRVNILKPIKVYLTIFCGLLAIGLFAALLIGNYWSDNARI
HGSLATSTSKRTHPLRPVSRGPAQGVSEKTSGIWAGVSRGPTQGVSEKTNRVRAGVPWNI
LPEPWNSTMLEWQRTAFHFQPEKNWMNDPNGPLFYNGWYHFFYQYNPNGAVWGDIVWGHA
VSKDLINWFHLPLAMVADQWYDKNGVWTGSATILPDGKIVMLYTGSTTEAVQVQNLAFPA
NHSDPFLIDWVKYHGNPVLVPPPGIYKKDFRDPTTAWLTSEGKWRITIGSKRDKTGISLV
YDTKDFINYEMLEGELHAVSGTGMWECVDFFPVSKTEEKGLDTSINGPEVKHVVKVSLDD
DRHDYYALGTYHEKNGSWIPDLPEIDVGIGIRYDYGIFYASKTFYDQNKNRRVLWGWIGE
GDSEAADMEKGWASLQSIPRTILFDNNTGTNLLQWPVEEIESLRLNSTEFEKVEVKAGSV
VPLDVGPGSQLDIIAEFEMDKEALKKATGSNITFSCQTGGGAAKSGALGPFGILVLADES
LSEQTPVYFYIAKDSDGDLKTFFCTDLSRSSKAPDVDKQIFGSYVPVLKDENLSLRVLVD
HSIVESFAQGGRTVITSRIYPTEAIDGASRVFLFNNATETCVIASVKIWQMDSAFIRPYS
DDDDKDDDDRKSSAPCLLLCPINYIVSCVTCLYFIYLVSKLS
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggtggatactaaaccattgcttccagcatccaactccgatgggtcttatctaacaggc
tctcgtgtaaatatcctgaaacccatcaaagtttatcttacaatcttttgtgggttgttg
gcgatcggcttgttcgcggcattgttgataggaaactattggtctgataatgctcgtata
catggctcattggctacgtcaacctctaagagaactcatcctttacgtcctgtatcacgt
ggcccggctcaaggagtttcggagaaaacgagcgggatttgggccggcgtatcacgtggc
ccgactcaaggagtatcagagaaaacgaacagggttagggctggcgtcccctggaatatc
ttgccggaaccatggaacagtaccatgttggaatggcaaagaactgcttttcattttcaa
cctgaaaagaattggatgaatgatccaaacggtccactgttctataatggatggtatcat
ttcttctaccagtacaatcccaatggtgctgtttggggtgacattgtttggggccatgcg
gtgtcgaaagacttaattaattggttccacctcccattggcaatggttgctgaccaatgg
tacgacaaaaatggcgtctggaccggttctgccaccatccttcctgatggaaaaattgtg
atgctatacacaggatccaccacggaggctgttcaggttcaaaaccttgcttttcctgct
aatcactccgacccttttctcatcgattgggtcaagtaccatgggaacccggttctagtt
ccacccccaggcatctataaaaaggatttccgtgatccaaccactgcctggttgacctct
gaagggaaatggcgcattaccatagggtccaagagagataaaaccggcatatctttggta
tatgataccaaggacttcataaactatgagatgttagagggggaacttcatgcggtgtcc
ggcactggcatgtgggagtgtgtggatttcttccctgtttctaaaacagaagagaagggc
ttggacacatctatcaatggacccgaagttaagcatgtggtgaaggtaagcctggatgat
gacaggcatgattactatgctcttgggacgtatcatgagaagaatggttcatggattcct
gatctacctgaaatcgatgttggcatcggaataaggtatgattatggaatattttatgct
tccaagactttctatgatcagaacaaaaacagaagagttttgtggggttggataggggaa
ggtgatagtgaagccgcggatatggagaaaggatgggcatcgcttcagagcataccaagg
acgatattgtttgacaataatactggtactaatttgcttcaatggccagtggaagaaata
gagagtttaaggttgaacagcaccgaatttgaaaaggttgaagtcaaggcaggatcagtt
gttcctcttgatgttggtccaggctcacagttggatatcatagccgagtttgagatggat
aaagaagctttgaagaaagcaaccgggtccaatataacattcagctgccaaaccggcggt
ggagctgccaaaagtggtgcactgggaccatttggtattttggtgcttgcagatgagagc
ctcagtgagcaaactccggtgtacttctacatcgccaaagattcagatggcgatctcaag
accttcttctgcaccgatctgtctcgatcatctaaagcacccgatgttgataaacaaatt
tttgggagctacgttccagtactcaaagacgaaaacttatccctcagagtattggtggat
cattcgattgtggaaagctttgcacaaggtggaagaacagtgatcacatctcggatttat
ccaacagaagcaatcgatggagcaagtagagtgtttttattcaacaatgctactgagacc
tgtgttattgcttccgttaagatctggcaaatggactctgctttcattcggccttattca
gatgatgatgataaagatgatgacgaccggaaatcctctgcgccctgtctccttttgtgc
cctatcaattatatagtgtcatgtgtcacttgtctttacttcatatatctcgtttcaaaa
cttagttag

DBGET integrated database retrieval system