KEGG   Gossypium hirsutum (upland cotton): 107933480Help
Entry
107933480         CDS       T04793                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ghi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    107933480
   00500 Starch and sucrose metabolism
    107933480
Enzymes [BR:ghi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107933480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 645 aa AA seqDB search
MEASSSTSHDPALFHAPLLHHPRRRSSRPLKGFAVIFGSVVFLLSLVILIVNQSPEPLAS
NPSSVTEAGSYSMAAQPRGIAEGVSAKSNPSLFDKVGFNWTNAMFYWQRTAYHFQPQKNW
MNDPDGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWFYLPLAMVPDQWYDING
CWTGSATLLPDGRIVMLYTGSTNESVQVQNLAYPANLSDPLLLQWLKYPGNPVVVPPTGI
EDNEFRDPTTAWLGPDGSWRITVGTRFNTTIGTALVFQTTNFSDYQLLDGVLHAVPGTGM
WECVDFYPVAINGSVGLDTTALGPGIKHVLKASLDDTKVDHYAIGTYDMITDKWTPDNPE
EDVGIGLKVDYGRYYASKTFFDQSKQRRILYGWVNETDTEADDLEKGWASIQTIPRSVLY
DNKTGTHLLQWPVEEVESLRLNATVFKDVVVEAGSVVPLDIGTATQLDILAEFEIETLVS
NSTEDEVSDCGDGAVDRNTYGPFGVLVIADDSLSELTPIYFRPLNISDGSLETYFCADET
RSSKAPNVTKRVYGGKVPVLDDENYNMRVLVDHSVVESFGEGGRTVITSRVYPTEAIYGA
ARLFLFNNASGVNVKATLKIWEMNSAFIRPFPFEETLFQEMVAST
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggaggccagcagcagcacctcccatgacccagcattgttccatgctcccttgctacac
caccctcggaggaggagcagcagacccttaaagggtttcgcagtgatatttgggtccgtc
gttttcctactctcactggtcatattaatcgttaaccaaagcccggagccattagcaagt
aaccccagtagtgtaacggaggcagggtcgtattcaatggcggcgcagccaagagggata
gctgaaggagtttcagccaagtcaaacccatcactttttgacaaagttgggtttaattgg
acaaacgctatgttttactggcaaagaactgcctaccactttcagcctcaaaagaattgg
atgaatgatcctgacggtccgttatatcacaagggatggtaccatcttttctatcaatac
aaccctgattcagccatatggggcaacatcacttggggccacgctgtatcaaaggacctc
attcactggttctatctcccactcgccatggttcctgatcaatggtacgatatcaatggt
tgctggacggggtcggccactctccttccagatggccgaatcgtaatgctttacaccggc
agcaccaatgagtccgtgcaagtccaaaaccttgcatatcccgccaacctatctgatccc
ctcctccttcagtggttaaaatacccgggtaacccggttgttgttcccccaaccgggatc
gaagacaatgagttccgagacccgacaacagcttggcttggacccgatggttcctggcgg
attactgttggtacaaggtttaataccaccataggaacagcccttgttttccaaacgaca
aacttttcggactatcaattattggatggggtcttacatgctgttccgggcacgggtatg
tgggaatgtgtagatttttaccccgttgcaataaacgggtccgtcggacttgacacgacg
gcacttgggcctggaattaaacatgtcctgaaggctagtttggatgatacgaaagttgat
cattatgcaatagggacctacgacatgataacggataaatggacacccgataacccggaa
gaagatgtaggcatcgggttgaaagtggattatgggagatactatgcctccaagacattt
tttgatcagagtaaacaaaggaggattctttatggttgggttaatgaaactgatactgaa
gctgatgacctcgaaaaaggatgggcttccattcagacaattcccaggagtgtgttgtat
gacaacaagaccggaacccatttactacagtggcctgtggaagaagtggagagcttgaga
ctgaatgctacagtgtttaaggatgttgtagttgaagcaggatcagttgtgcccctcgac
ataggcaccgctactcagttggatatattagcagagtttgaaatagagacgttggtatcg
aacagcacggaggatgaagtcagtgattgcggtgatggggcggttgataggaacacttac
gggccatttggggtcctggttattgctgatgattcactttctgagctcactcctatatat
ttccgtccacttaatatatccgatgggagtcttgaaacttacttttgcgctgatgaaaca
aggtcttctaaagctcccaatgtcacgaaacgagtgtatggaggcaaagttccagtgctt
gacgatgaaaactacaatatgagggtattggtggatcattcagtagtggaaagctttgga
gaaggagggaggacggtgataacatcaagagtgtatccaacggaagccatatatggagca
gcacggctgttcttgttcaacaatgcaagtggagtgaatgtgaaggccacactcaaaata
tgggagatgaattctgcttttattcgtcctttcccctttgaagaaacattatttcaggaa
atggttgcttccacatga

DBGET integrated database retrieval system