KEGG   Geobacillus genomosp. 3: M493_00040Help
Entry
M493_00040        CDS       T02798                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
gjf  Geobacillus genomosp. 3
Pathway
gjf00360  Phenylalanine metabolism
gjf00362  Benzoate degradation
gjf00620  Pyruvate metabolism
gjf00621  Dioxin degradation
gjf00622  Xylene degradation
gjf00650  Butanoate metabolism
gjf01100  Metabolic pathways
gjf01120  Microbial metabolism in diverse environments
gjf01220  Degradation of aromatic compounds
Module
gjf_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:gjf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M493_00040
   00650 Butanoate metabolism
    M493_00040
  Amino acid metabolism
   00360 Phenylalanine metabolism
    M493_00040
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M493_00040
   00622 Xylene degradation
    M493_00040
   00621 Dioxin degradation
    M493_00040
Enzymes [BR:gjf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     M493_00040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AGT33887
UniProt: S5ZAN6
Position
pBt40:6756..7643
Genome map
AA seq 295 aa AA seqDB search
MGKIKAGIIGSGNIGTDLLMKLLRSDVLEPTVMIGIDPQSDGLRRAKDYGLVTYDNGIEG
FLQKPDDADILFDATSAKAHFRHAKLLKEAGKQVLDLTPAAVGPFVVPPVNLGEHMGEPN
INLITCGGQATIPIVHAVNRVCPVQYAEIVATISSQSAGPGTRANIDEFTQTTARGLELI
GGAKRGKAIIILNPAEPPIIMRDTVYCLVEEGKVDEDAITRSVVDMVQTVQSYVPGYRLR
TEPIFDGNKVTVFLEVEGAGDYLPKYSGNLDIMTAAAVKVAEEWAKNKLAKEVVS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaatcaaagcggggatcatcggatccggcaacatcgggacagatttgttaatg
aaattgttgcgttccgacgtgttggaaccgacggtgatgatcggcatcgatccgcaatcg
gatgggttgcggcgcgcgaaggactacggtttggtgacctacgacaatgggatcgaaggc
tttttgcagaaaccggatgatgcggatatcctgtttgatgcgacttcggcgaaagcgcac
ttccgtcatgcgaagctattgaaggaagcgggaaaacaagtgctcgacttgacgccggcg
gcggtcggcccgttcgtcgttccgcccgttaatttgggggaacatatgggagaaccgaat
atcaatctcatcacgtgcggggggcaagcgacgattccgatcgtccatgccgtcaatcgc
gtctgccccgtgcaatatgcagaaatcgtcgccacgatttccagccaaagcgcggggccg
ggaacgcgggcaaacatcgatgagtttacgcagacgacggcgcgcggcttggagctaatc
ggcggcgcgaaaaggggcaaggcgatcatcatcttgaatcctgctgaaccgccgatcatc
atgcgggatacggtttattgcttggttgaagaaggaaaggttgatgaagacgcgatcaca
cggtcggtcgtcgacatggtgcaaacggtgcaatcgtatgtgcctggctatcgcttgcgc
acggaaccgatttttgacggcaataaagtgacggtctttttggaagtggaaggtgcgggc
gattatttgcccaagtattccggaaacttggatatcatgacggcggcggccgtaaaagtg
gcggaagaatgggccaagaacaaattggcgaaagaggttgtctcgtaa

DBGET integrated database retrieval system